(data stored in SCRATCH zone)

EMBL: CP002105.PE128

CP002105.PE128       Location/Qualifiers
FT   CDS             144738..145265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0129"
FT                   /product="UvrB/UvrC protein"
FT                   /note="COGs: COG3880 Uncharacterized protein with conserved
FT                   CXXC pairs; InterPro IPR001943:IPR009055; KEGG:
FT                   hor:Hore_00850 UvrB/UvrC protein; PFAM: UvrB/UvrC protein;
FT                   SPTR: B8D092 UvrB/UvrC protein; PFAM: UvrB/uvrC motif"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11680"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSZ2"
FT                   /protein_id="ADL11680.1"
FT                   /translation="MLCQECQKREATVHLTKIINNKKKEIYLCDKCAQEKEELNFGKEG
FT                   FSFNNLLAGLLSSESGSNTPNSNLNLSYNKAQAECEDCGLNYAEFSRQGKLGCSECYTE
FT                   FEDKINKVLKKVHGNNRHTGKVPKRTGGVIRTRKEIQKLRKKMQEAVQEEEFEEAARLR
FT                   DEIKELEEKIEE"
     MLCQECQKRE ATVHLTKIIN NKKKEIYLCD KCAQEKEELN FGKEGFSFNN LLAGLLSSES        60
     GSNTPNSNLN LSYNKAQAEC EDCGLNYAEF SRQGKLGCSE CYTEFEDKIN KVLKKVHGNN       120
     RHTGKVPKRT GGVIRTRKEI QKLRKKMQEA VQEEEFEEAA RLRDEIKELE EKIEE            175
//

If you have problems or comments...

PBIL Back to PBIL home page