(data stored in SCRATCH zone)

EMBL: CP002105.PE135

CP002105.PE135       Location/Qualifiers
FT   CDS             153312..154004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0136"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="COGs: COG1211
FT                   4-diphosphocytidyl-2-methyl-D-erithritol synthase; InterPro
FT                   IPR018294:IPR001228; KEGG: cce:Ccel_0342
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   SPTR: C6PB55 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; TIGRFAM: 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; PFAM: Uncharacterized
FT                   protein family UPF0007; TIGRFAM: 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11687"
FT                   /db_xref="GOA:D9QSZ9"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSZ9"
FT                   /protein_id="ADL11687.1"
FT                   /translation="MESITAIIPAAGQGKRMKSKLNKQYLSLLDKPVLAHTVEVFQNCD
FT                   LITEIIVVVKEDEIDYCRRKVIEKYNYNKVKALIRGGQSRQKSVHNGLQSVDNADYVLI
FT                   HDGARPLLTEDMLCRAVDQVKDYKAVGVAVPVKDTIKRIDNDGYVAETPVRDKLWAIQT
FT                   PQAFEYSLVSEAYNKAMKEGISGTDTSILVERLGQKVKLIRGSYENLKITTPEDLINAE
FT                   AIIKRRQQ"
     MESITAIIPA AGQGKRMKSK LNKQYLSLLD KPVLAHTVEV FQNCDLITEI IVVVKEDEID        60
     YCRRKVIEKY NYNKVKALIR GGQSRQKSVH NGLQSVDNAD YVLIHDGARP LLTEDMLCRA       120
     VDQVKDYKAV GVAVPVKDTI KRIDNDGYVA ETPVRDKLWA IQTPQAFEYS LVSEAYNKAM       180
     KEGISGTDTS ILVERLGQKV KLIRGSYENL KITTPEDLIN AEAIIKRRQQ                  230
//

If you have problems or comments...

PBIL Back to PBIL home page