(data stored in SCRATCH zone)

EMBL: CP002105.PE137

CP002105.PE137       Location/Qualifiers
FT   CDS             154502..155275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0138"
FT                   /product="CBS domain containing protein"
FT                   /note="COGs: COG0517 FOG: CBS domain; InterPro
FT                   IPR000644:IPR015111:IPR013785; KEGG: hor:Hore_00940 CBS
FT                   domain containing protein; PFAM: CBS domain containing
FT                   protein; HutP family protein; SMART: CBS domain containing
FT                   protein; SPTR: B8D0A1 CBS domain containing protein; PFAM:
FT                   HutP; CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11689"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR015111"
FT                   /db_xref="UniProtKB/TrEMBL:D9QT01"
FT                   /protein_id="ADL11689.1"
FT                   /translation="MIVKDIMIKDVITVNENVTISEAERIMTVNDIGRLIVEDDLGKVV
FT                   GMITDGDLVKERNFDLKVKEIMTTDLIKGYQTQSIQEVAQIVSDNQIGGVPIFDETDNL
FT                   VGIVTVDDIVSGYMKEENTAKISPESSAIYLSMTRSREYENYWLDKINGYGYKAAITQT
FT                   GANAEDLPIKLRESATVAAIARKVIKERAKEKVAVSNAVRDAYNQLNLINPGLGGGFKV
FT                   AIVRGEGKVAVSAFGKFGHALVDGPEQIALGTSII"
     MIVKDIMIKD VITVNENVTI SEAERIMTVN DIGRLIVEDD LGKVVGMITD GDLVKERNFD        60
     LKVKEIMTTD LIKGYQTQSI QEVAQIVSDN QIGGVPIFDE TDNLVGIVTV DDIVSGYMKE       120
     ENTAKISPES SAIYLSMTRS REYENYWLDK INGYGYKAAI TQTGANAEDL PIKLRESATV       180
     AAIARKVIKE RAKEKVAVSN AVRDAYNQLN LINPGLGGGF KVAIVRGEGK VAVSAFGKFG       240
     HALVDGPEQI ALGTSII                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page