(data stored in SCRATCH zone)

EMBL: CP002105.PE138

CP002105.PE138       Location/Qualifiers
FT   CDS             155390..156856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0139"
FT                   /product="glutamyl-tRNA synthetase ;glutamate--tRNA(Gln)
FT                   ligase"
FT                   /EC_number="6.1.1.17"
FT                   /EC_number="6.1.1.24"
FT                   /note="COGs: COG0008 Glutamyl- and glutaminyl-tRNA
FT                   synthetase;
FT                   InterProIPR001412:IPR020058:IPR014729:IPR020061:IPR
FT                   020751:IPR008925:IPR020060:IPR004527; KEGG: hor:Hore_00950
FT                   glutamyl-tRNA synthetase; PFAM: Glutamyl/glutaminyl-tRNA
FT                   synthetase, class Ic, catalytic domain; SPTR: B8D0A2
FT                   Glutamyl-tRNA synthetase; TIGRFAM: glutamyl-tRNA
FT                   synthetase; PFAM: tRNA synthetases class I (E and Q),
FT                   catalytic domain; TIGRFAM: glutamyl-tRNA synthetase,
FT                   bacterial family"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11690"
FT                   /db_xref="GOA:D9QT02"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D9QT02"
FT                   /protein_id="ADL11690.1"
FT                   /translation="MSDIRVRFAPSPTGQIHIGNIRTALFTWLYARKHNGTTVLRIEDT
FT                   DQERSTSEFEEIILQETDWLGLDWDEGVRAGGDYGPYRQSDRLDIYDKYIDRLIEEDKA
FT                   YYCYCTDEELEQMREEAKAKGKPPKYNGRCRNLSEEERKELEAEGREPAVRFKMPTEEI
FT                   KIVVNDLVHGEVEFSSEVLDDFVIVKSDGLPTYNFAVVIDDHLMEISHVIRGEDHLSNT
FT                   PKQQLIYDALDWEMPEFGHLPMILGEDKSKLSKRSGEAYVYVSEYRQKGYLPEALINFL
FT                   ALLGWSSADDEELFTVEEIIDNFSMERVNNSPSVFDVEKLNWMNGHHIRESELDRIVDL
FT                   AIPYLQEAGYIADELSDEEYNYVAQIVDVVRDSLDYVAQITDHVDIFFGELEYENKEEV
FT                   IDCFQQEDVDLVLETLKDRLAVLDDYSPDSVLEEMRAILNDLPVGGRLFYHPTRYALTG
FT                   KGSGPELYQVVSILGKEETINRLDKALNLV"
     MSDIRVRFAP SPTGQIHIGN IRTALFTWLY ARKHNGTTVL RIEDTDQERS TSEFEEIILQ        60
     ETDWLGLDWD EGVRAGGDYG PYRQSDRLDI YDKYIDRLIE EDKAYYCYCT DEELEQMREE       120
     AKAKGKPPKY NGRCRNLSEE ERKELEAEGR EPAVRFKMPT EEIKIVVNDL VHGEVEFSSE       180
     VLDDFVIVKS DGLPTYNFAV VIDDHLMEIS HVIRGEDHLS NTPKQQLIYD ALDWEMPEFG       240
     HLPMILGEDK SKLSKRSGEA YVYVSEYRQK GYLPEALINF LALLGWSSAD DEELFTVEEI       300
     IDNFSMERVN NSPSVFDVEK LNWMNGHHIR ESELDRIVDL AIPYLQEAGY IADELSDEEY       360
     NYVAQIVDVV RDSLDYVAQI TDHVDIFFGE LEYENKEEVI DCFQQEDVDL VLETLKDRLA       420
     VLDDYSPDSV LEEMRAILND LPVGGRLFYH PTRYALTGKG SGPELYQVVS ILGKEETINR       480
     LDKALNLV                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page