(data stored in SCRATCH zone)

EMBL: CP002105.PE143

CP002105.PE143       Location/Qualifiers
FT   CDS             160451..161182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0144"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="COGs: COG0566 rRNA methylase; InterPro
FT                   IPR013123:IPR001537:IPR004441; KEGG: cdf:CD0055 putative
FT                   tRNA/rRNA methyltransferase; PFAM: tRNA/rRNA
FT                   methyltransferase (SpoU); RNA 2-O ribose methyltransferase
FT                   substrate binding; SPTR: Q18CE0 Putative tRNA/rRNA
FT                   methyltransferase; TIGRFAM: RNA methyltransferase, TrmH
FT                   family, group 3; PFAM: SpoU rRNA Methylase family; RNA 2'-O
FT                   ribose methyltransferase substrate binding; TIGRFAM: rRNA
FT                   methylase, putative, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11695"
FT                   /db_xref="GOA:D9QTD1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTD1"
FT                   /protein_id="ADL11695.1"
FT                   /translation="MKKIEGRNPVMEALKSERRIDEILIYQNAEGVNELLKKAKAEGIK
FT                   LKRVAKEKLDNLADSYSHQGVIAFGEPIKYLSLDQLIDKAYNKTDDPLFILLDEIKDPH
FT                   NFGSILRTADAVGAQGVIIPKRRSVGLTSAVGKASAGAIEHIPVAQVTNLVRAMEELKE
FT                   NRFWIAGADMEAEGFCYQQDLTGPLGIVIGSEGAGMRRLVKERCDFLIKLPMKGRINSL
FT                   NAAVAGAVLMYEALRQRNYSD"
     MKKIEGRNPV MEALKSERRI DEILIYQNAE GVNELLKKAK AEGIKLKRVA KEKLDNLADS        60
     YSHQGVIAFG EPIKYLSLDQ LIDKAYNKTD DPLFILLDEI KDPHNFGSIL RTADAVGAQG       120
     VIIPKRRSVG LTSAVGKASA GAIEHIPVAQ VTNLVRAMEE LKENRFWIAG ADMEAEGFCY       180
     QQDLTGPLGI VIGSEGAGMR RLVKERCDFL IKLPMKGRIN SLNAAVAGAV LMYEALRQRN       240
     YSD                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page