(data stored in SCRATCH zone)

EMBL: CP002105.PE144

CP002105.PE144       Location/Qualifiers
FT   CDS             161205..162530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0145"
FT                   /product="VanW family protein"
FT                   /note="COGs: COG2720 Uncharacterized vancomycin resistance
FT                   protein; InterPro IPR007391:IPR011098; KEGG: chy:CHY_0544
FT                   VanW domain-containing protein; PFAM: VanW family protein;
FT                   G5 domain protein; SPTR: A1HTH4 VanW family protein; PFAM:
FT                   Putative peptidoglycan binding domain; VanW like protein;
FT                   G5 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11696"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTD2"
FT                   /protein_id="ADL11696.1"
FT                   /translation="MKNSLLAALVALTLLFSIGLGIYIGSYFFFKQHEDVIFSGVMIEG
FT                   YDFSGLTKKQAKERLKKLTEPLLQEPLVLERDNDKWLLRPDDIELKFKNRGALNKAFGI
FT                   GRSGTLLQRSIAVWQSAEYGKSLTVDISYNEDKLDEKLQQIANEVNISSSNAYLDLETE
FT                   ELISFQLGKRLRLEESKQKIISRFNNFKKIPVKLVIEKKVPEVNREKLKEWNLTNQLSS
FT                   YKTSFDTEKENRVHNIKLAAQKINATLLKSGEVFSFNQTVGRRSLKNGFKQATEIVNQE
FT                   FVTGVGGGVCQVSSTLYNAVLLGDLKVLERHNHSRPVGYIPLGRGAAIYNGYLDFKFKN
FT                   TSSDPIMILAKVLENSLEIAIMGQSKDYQIEISTSQPKVLDYGQVKKKAKVEERKVVKE
FT                   GKQGYQVKVVKKIIVDNELINKEIISQDVYQPVDKVIKVPVK"
     MKNSLLAALV ALTLLFSIGL GIYIGSYFFF KQHEDVIFSG VMIEGYDFSG LTKKQAKERL        60
     KKLTEPLLQE PLVLERDNDK WLLRPDDIEL KFKNRGALNK AFGIGRSGTL LQRSIAVWQS       120
     AEYGKSLTVD ISYNEDKLDE KLQQIANEVN ISSSNAYLDL ETEELISFQL GKRLRLEESK       180
     QKIISRFNNF KKIPVKLVIE KKVPEVNREK LKEWNLTNQL SSYKTSFDTE KENRVHNIKL       240
     AAQKINATLL KSGEVFSFNQ TVGRRSLKNG FKQATEIVNQ EFVTGVGGGV CQVSSTLYNA       300
     VLLGDLKVLE RHNHSRPVGY IPLGRGAAIY NGYLDFKFKN TSSDPIMILA KVLENSLEIA       360
     IMGQSKDYQI EISTSQPKVL DYGQVKKKAK VEERKVVKEG KQGYQVKVVK KIIVDNELIN       420
     KEIISQDVYQ PVDKVIKVPV K                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page