(data stored in SCRATCH zone)

EMBL: CP002105.PE150

CP002105.PE150       Location/Qualifiers
FT   CDS             165971..166402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0151"
FT                   /product="ribosomal protein L11"
FT                   /note="COGs: COG0080 Ribosomal protein L11; InterPro
FT                   IPR020784:IPR020783:IPR000911:IPR006519; KEGG:
FT                   hor:Hore_01050 ribosomal protein L11; PFAM: Ribosomal
FT                   protein L11-like; SMART: ribosomal protein L11; SPTR:
FT                   B8D0B2 50S ribosomal protein L11; TIGRFAM: ribosomal
FT                   protein L11; PFAM: Ribosomal protein L11, RNA binding
FT                   domain; Ribosomal protein L11, N-terminal domain; TIGRFAM:
FT                   50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11702"
FT                   /db_xref="GOA:D9QTD8"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTD8"
FT                   /protein_id="ADL11702.1"
FT                   /translation="MAKKVVGEISLQIPAGEANPAPPVGPALGQHGVNIMEFCKAFNAK
FT                   TADKAGNIIPVEITVYADRSFDFITKSPPAADLLKKAAGIDSGSGEPNINKVGTVTKKD
FT                   LEEIAKTKMEDLNAANLEAAMRMIAGTARSAGIVVEDEE"
     MAKKVVGEIS LQIPAGEANP APPVGPALGQ HGVNIMEFCK AFNAKTADKA GNIIPVEITV        60
     YADRSFDFIT KSPPAADLLK KAAGIDSGSG EPNINKVGTV TKKDLEEIAK TKMEDLNAAN       120
     LEAAMRMIAG TARSAGIVVE DEE                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page