(data stored in SCRATCH zone)

EMBL: CP002105.PE151

CP002105.PE151       Location/Qualifiers
FT   CDS             166454..167146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0152"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="COGs: COG0081 Ribosomal protein L1; InterPro
FT                   IPR002143:IPR016094:IPR005878; KEGG: hor:Hore_01060
FT                   ribosomal protein L1; PFAM: ribosomal protein L1; SPTR:
FT                   B8D0B3 50S ribosomal protein L1; TIGRFAM: ribosomal protein
FT                   L1; PFAM: Ribosomal protein L1p/L10e family; TIGRFAM:
FT                   ribosomal protein L1, bacterial/chloroplast"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11703"
FT                   /db_xref="GOA:D9QTD9"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTD9"
FT                   /protein_id="ADL11703.1"
FT                   /translation="MSRRYEEVLAEVDRDKVYQPEEALELAKETATANFDETIEIAFKL
FT                   GIDPGKNDQQLRDALVLPQGTGQEVKVVVFAQGEKAKEAEEAGADVVGSEDLAEKIEEG
FT                   WLDFDVAIATPDMMSVVGKLGPILGPKGLMPNPKVGTVTFELERAIEDIKAGKIEYRAD
FT                   DGGNVHLPLGKASFEVEELLENLEAVCDEIVRARPSGAKGRYILNMTVSATMGPGIKID
FT                   PQFARDMV"
     MSRRYEEVLA EVDRDKVYQP EEALELAKET ATANFDETIE IAFKLGIDPG KNDQQLRDAL        60
     VLPQGTGQEV KVVVFAQGEK AKEAEEAGAD VVGSEDLAEK IEEGWLDFDV AIATPDMMSV       120
     VGKLGPILGP KGLMPNPKVG TVTFELERAI EDIKAGKIEY RADDGGNVHL PLGKASFEVE       180
     ELLENLEAVC DEIVRARPSG AKGRYILNMT VSATMGPGIK IDPQFARDMV                  230
//

If you have problems or comments...

PBIL Back to PBIL home page