(data stored in SCRATCH zone)

EMBL: CP002105.PE155

CP002105.PE155       Location/Qualifiers
FT   CDS             171956..175432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0156"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0086 DNA-directed RNA polymerase beta'
FT                   subunit/160 kD subunit;
FT                   InterProIPR007080:IPR000722:IPR007066:IPR007083:IPR
FT                   007081:IPR006592:IPR012754; KEGG: hor:Hore_01100
FT                   DNA-directed RNA polymerase, beta' subunit; PFAM: RNA
FT                   polymerase Rpb1 domain 1; RNA polymerase alpha subunit; RNA
FT                   polymerase Rpb1 domain 3; RNA polymerase Rpb1 domain 4; RNA
FT                   polymerase Rpb1 domain 5; SMART: RNA polymerase I subunit A
FT                   domain protein; SPTR: B8D0B7 DNA-directed RNA polymerase;
FT                   TIGRFAM: DNA-directed RNA polymerase, beta' subunit; PFAM:
FT                   RNA polymerase Rpb1, domain 2; RNA polymerase Rpb1, domain
FT                   4; RNA polymerase Rpb1, domain 1; RNA polymerase Rpb1,
FT                   domain 3; RNA polymerase Rpb1, domain 5; TIGRFAM:
FT                   DNA-directed RNA polymerase, beta' subunit, predominant
FT                   form"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11707"
FT                   /db_xref="GOA:D9QTE3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR012756"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTE3"
FT                   /protein_id="ADL11707.1"
FT                   /translation="MLNVNNFDSMKIGLASPEQIRNWSSGEVKKPETINYRTLKPEKEG
FT                   LFCEKIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRLGLVMDMSPRSLEKALYFVSYIVIEPGDTPLSEKQLLSEDEYREAKIKYG
FT                   DSFKAGMGAEAVKEILKNMDLDKEVEELRAEIKDISGQRRKRAVRRLKVVDGLRKSDNK
FT                   PEWMVLDVIPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIII
FT                   RNEKRMLQEAVDALIDNGRRGRAVTGSGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPDLKMHECGLPKKMALELFKPFVMKKLVEEDLAHNIKSAKGKVEKLDEEVWD
FT                   ILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGKAIKIHPLICPPYNADFDGDQMAVH
FT                   VPLSAEAQAESRLLMLSTYNLLSPADGEAIAVPSQDMVLGAYHMTMKEEGVKGEGKFFG
FT                   DVDEVLKAYENDVVDIHAEIKYKLEEEWIETTVGRVLFNDIFPEELEFQNEVFDKGRLS
FT                   DLVGNCHDKFGPNQTADLLDDLEEITFEYSTKSGITIGVTDVRVPEEKPEILQKSEDKV
FT                   HQIEEQYKRGLITEKERYQRVIDIWGTAKDRVTEEMVDGLPETNSIYMMATSGARGNTS
FT                   QITQLGGMRGLMTDPSGQIIDLPIKANFREGLTVLEYFISTHGARKGLADTALRTADSG
FT                   YLTRRLVDVSQDVIVREEECGTDDGILVEAIKEEGEVIEPLEERIVGRLANTDIEHPET
FT                   GETIVEKDEMITEDTAAEIAEAGLEEVEIRSILTCRTKNGVCCKCYGENLATGRLVDVG
FT                   EAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDITQGLPRVEELFEARTPKGQAIVTELS
FT                   GKIKLVETANSHKAVIKTDDGKQKTYKLPYGSTMKIEDGDYVETGQRLTKGPLDPEDIL
FT                   NIRGARAVQKYLLREVQDVYRSQGVEIDDKHMEVVIRQMLDKVKVKEAGDTDLLPGKLV
FT                   NVFEFEETNNEAITEGKEPATAEPELLGITKASLATESFLSAASFQETTRVLTESSLDG
FT                   QNDSLVGLKENVIIGQLIPAGTGMKRYRDIDIDITEEEDQKDEIAEVEKVK"
     MLNVNNFDSM KIGLASPEQI RNWSSGEVKK PETINYRTLK PEKEGLFCEK IFGPTKDWEC        60
     HCGKYKRVRY KGVVCDRCGV EVTRSKVRRE RMGHIELAAP VSHIWYFKGI PSRLGLVMDM       120
     SPRSLEKALY FVSYIVIEPG DTPLSEKQLL SEDEYREAKI KYGDSFKAGM GAEAVKEILK       180
     NMDLDKEVEE LRAEIKDISG QRRKRAVRRL KVVDGLRKSD NKPEWMVLDV IPVIPPELRP       240
     MVQLDGGRFA TSDLNDLYRR VINRNNRLKR LLDLGAPDII IRNEKRMLQE AVDALIDNGR       300
     RGRAVTGSGN RPLKSLSDML KGKQGRFRQN LLGKRVDYSG RSVIVVGPDL KMHECGLPKK       360
     MALELFKPFV MKKLVEEDLA HNIKSAKGKV EKLDEEVWDI LEEVIKEHPV LLNRAPTLHR       420
     LGIQAFEPVL VEGKAIKIHP LICPPYNADF DGDQMAVHVP LSAEAQAESR LLMLSTYNLL       480
     SPADGEAIAV PSQDMVLGAY HMTMKEEGVK GEGKFFGDVD EVLKAYENDV VDIHAEIKYK       540
     LEEEWIETTV GRVLFNDIFP EELEFQNEVF DKGRLSDLVG NCHDKFGPNQ TADLLDDLEE       600
     ITFEYSTKSG ITIGVTDVRV PEEKPEILQK SEDKVHQIEE QYKRGLITEK ERYQRVIDIW       660
     GTAKDRVTEE MVDGLPETNS IYMMATSGAR GNTSQITQLG GMRGLMTDPS GQIIDLPIKA       720
     NFREGLTVLE YFISTHGARK GLADTALRTA DSGYLTRRLV DVSQDVIVRE EECGTDDGIL       780
     VEAIKEEGEV IEPLEERIVG RLANTDIEHP ETGETIVEKD EMITEDTAAE IAEAGLEEVE       840
     IRSILTCRTK NGVCCKCYGE NLATGRLVDV GEAVGIIAAQ SIGEPGTQLT MRTFHTGGVA       900
     GDDITQGLPR VEELFEARTP KGQAIVTELS GKIKLVETAN SHKAVIKTDD GKQKTYKLPY       960
     GSTMKIEDGD YVETGQRLTK GPLDPEDILN IRGARAVQKY LLREVQDVYR SQGVEIDDKH      1020
     MEVVIRQMLD KVKVKEAGDT DLLPGKLVNV FEFEETNNEA ITEGKEPATA EPELLGITKA      1080
     SLATESFLSA ASFQETTRVL TESSLDGQND SLVGLKENVI IGQLIPAGTG MKRYRDIDID      1140
     ITEEEDQKDE IAEVEKVK                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page