(data stored in SCRATCH zone)

EMBL: CP002105.PE157

CP002105.PE157       Location/Qualifiers
FT   CDS             176046..176516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0158"
FT                   /product="ribosomal protein S7"
FT                   /note="COGs: COG0049 Ribosomal protein S7; InterPro
FT                   IPR000235:IPR005717; KEGG: hor:Hore_01130 ribosomal protein
FT                   S7; PFAM: ribosomal protein S7; SPTR: B8D0C0 30S ribosomal
FT                   protein S7; TIGRFAM: ribosomal protein S7; PFAM: Ribosomal
FT                   protein S7p/S5e; TIGRFAM: ribosomal protein S7,
FT                   bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11709"
FT                   /db_xref="GOA:D9QTE5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTE5"
FT                   /protein_id="ADL11709.1"
FT                   /translation="MSRKNIAGRKDITPDPVFNSRLVTKAINKVMYDGKKSLAEKIFYK
FT                   AMAVIEKNTGENALEVFKEALNNVMPVLEIKSRRVGGANYQVPVEVDNDRRLTLGLRWL
FT                   IEAARSRGERRMVARLANEIIDAYNEEGGAVRKKEEIHQMAEANKAFAHYRW"
     MSRKNIAGRK DITPDPVFNS RLVTKAINKV MYDGKKSLAE KIFYKAMAVI EKNTGENALE        60
     VFKEALNNVM PVLEIKSRRV GGANYQVPVE VDNDRRLTLG LRWLIEAARS RGERRMVARL       120
     ANEIIDAYNE EGGAVRKKEE IHQMAEANKA FAHYRW                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page