(data stored in SCRATCH zone)

EMBL: CP002105.PE158

CP002105.PE158       Location/Qualifiers
FT   CDS             176556..178625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0159"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="COGs: COG0480 Translation elongation factors
FT                   (GTPase);
FT                   InterProIPR000795:IPR004161:IPR005517:IPR000640:IPR
FT                   014721:IPR020568:IPR009000:IPR009022:IPR004540:IPR005225;
FT                   KEGG: hor:Hore_01140 translation elongation factor G; PFAM:
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; elongation factor G domain IV; elongation
FT                   factor G domain protein; SPTR: B8D0C1 Elongation factor G;
FT                   TIGRFAM: translation elongation factor G; small GTP-binding
FT                   protein; PFAM: Elongation factor Tu domain 2; Elongation
FT                   factor G C-terminus; Elongation factor Tu GTP binding
FT                   domain; Elongation factor G, domain IV; TIGRFAM:
FT                   translation elongation factor EF-G; small GTP-binding
FT                   protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11710"
FT                   /db_xref="GOA:D9QTE6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTE6"
FT                   /protein_id="ADL11710.1"
FT                   /translation="MARQFPLKKTRNIGIMAHIDAGKTTATERILFYTGRVHKMGETHD
FT                   GASQMDWMDQEQERGITITSAATTCQWRDHRINIIDTPGHVDFTVEVERSLRVLDGAIG
FT                   VFCSVGGVEPQSETVWRQADRYNVPRFAFVNKMDRTGADFYNVVDMMEERIDANPVPIQ
FT                   LPIGKEDDFIGVVDLVKMKAIVYRDELGVDYEEEEIPEDLQEQAELYREELLEAIADVD
FT                   EEIMMKYLEDEEITEDEIRDGIRQGVIENEFTPVMCGTALKNKGIQPMLDAVVDYLPSP
FT                   VDIPPIEGEVPGTEETEARPADDDEPFSALAFKIMTDPYVGKLAFFRAYSGILESGSYV
FT                   YNSTKEEKERVSRILQMHANHREERDQVYAGDLAAAVGLKNTSTGDTLCDEDNPIILES
FT                   MEFPEPVIAVAIEPKTQADQDKLGQALQSLAEEDPTFQVKTDEETGQTIISGMGELHLE
FT                   VIVDRLTREFNVEANIGAPQVAYRETIKEEVEAEGKFIRQSGGRGQYGHAVIEIEPLEA
FT                   GGGFEFEDNIVGGVIPRDYIPAVEDGVKEAMENGILAGYPMVDIKVSLNDGSHHEVDSS
FT                   EMAYKVAGSKAFRQGTKRANPVLLEPIMEVEVTTPEEYMGDVIGDLNGRRAQVEGMEQR
FT                   GNAKVIKAYVPLAEMFGYATDLRSKTQGRANYVMQFDHYGEVPNSIAKEIMDKE"
     MARQFPLKKT RNIGIMAHID AGKTTATERI LFYTGRVHKM GETHDGASQM DWMDQEQERG        60
     ITITSAATTC QWRDHRINII DTPGHVDFTV EVERSLRVLD GAIGVFCSVG GVEPQSETVW       120
     RQADRYNVPR FAFVNKMDRT GADFYNVVDM MEERIDANPV PIQLPIGKED DFIGVVDLVK       180
     MKAIVYRDEL GVDYEEEEIP EDLQEQAELY REELLEAIAD VDEEIMMKYL EDEEITEDEI       240
     RDGIRQGVIE NEFTPVMCGT ALKNKGIQPM LDAVVDYLPS PVDIPPIEGE VPGTEETEAR       300
     PADDDEPFSA LAFKIMTDPY VGKLAFFRAY SGILESGSYV YNSTKEEKER VSRILQMHAN       360
     HREERDQVYA GDLAAAVGLK NTSTGDTLCD EDNPIILESM EFPEPVIAVA IEPKTQADQD       420
     KLGQALQSLA EEDPTFQVKT DEETGQTIIS GMGELHLEVI VDRLTREFNV EANIGAPQVA       480
     YRETIKEEVE AEGKFIRQSG GRGQYGHAVI EIEPLEAGGG FEFEDNIVGG VIPRDYIPAV       540
     EDGVKEAMEN GILAGYPMVD IKVSLNDGSH HEVDSSEMAY KVAGSKAFRQ GTKRANPVLL       600
     EPIMEVEVTT PEEYMGDVIG DLNGRRAQVE GMEQRGNAKV IKAYVPLAEM FGYATDLRSK       660
     TQGRANYVMQ FDHYGEVPNS IAKEIMDKE                                         689
//

If you have problems or comments...

PBIL Back to PBIL home page