(data stored in SCRATCH zone)

EMBL: CP002105.PE16

CP002105.PE16        Location/Qualifiers
FT   CDS             22612..23058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0016"
FT                   /product="DNA-binding protein"
FT                   /note="COGs: COG1661 DNA-binding protein with PD1-like
FT                   DNA-binding motif; KEGG: dau:Daud_0493 DNA-binding protein;
FT                   SPTR: B1I1S9 DNA-binding protein with PD1-like DNA-binding
FT                   motif; PFAM: Domain of unknown function (DUF296)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11568"
FT                   /db_xref="GOA:D9QSB2"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSB2"
FT                   /protein_id="ADL11568.1"
FT                   /translation="MEYTEASIGRIFILRLETGDQIPETIEEFAETKGIDSATVLFIGG
FT                   ADKEGEVAVGPKDGSAKQPIPDTKKLSGVSEAIGAGTIFTNENKLPKLHLHSSFGRKDK
FT                   TITGCTKAGGIDIWNIGEVIILELNNHSAYRKIDPETGFELLEV"
     MEYTEASIGR IFILRLETGD QIPETIEEFA ETKGIDSATV LFIGGADKEG EVAVGPKDGS        60
     AKQPIPDTKK LSGVSEAIGA GTIFTNENKL PKLHLHSSFG RKDKTITGCT KAGGIDIWNI       120
     GEVIILELNN HSAYRKIDPE TGFELLEV                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page