(data stored in SCRATCH zone)

EMBL: CP002105.PE161

CP002105.PE161       Location/Qualifiers
FT   CDS             180308..180937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0162"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="COGs: COG0087 Ribosomal protein L3; InterPro
FT                   IPR019926:IPR000597:IPR009000:IPR019927; KEGG: tte:TTE2293
FT                   50S ribosomal protein L3; PFAM: ribosomal protein L3; SPTR:
FT                   Q8R7V4 50S ribosomal protein L3; TIGRFAM: 50S ribosomal
FT                   protein L3; PFAM: Ribosomal protein L3; TIGRFAM: 50S
FT                   ribosomal protein L3, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11713"
FT                   /db_xref="GOA:D9QTE9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTE9"
FT                   /protein_id="ADL11713.1"
FT                   /translation="MTREILGKKVGMTQIFDDEGEVIPVTVIEAGPCSIVQKKTEEKDG
FT                   YKAIQLGFGEAKESKLNKPLKGHFDKYGVEPKEYIREVRINEEDEYEVGDEIKADIFAV
FT                   GDRVDVTGTSKGKGFAGTVKRWNFNLGPKTHGSRNYRLPGSIGASADPARVFKGKKMPG
FT                   RMGREQVTIQNLKVAKVDPEKNILAVKGAVPGPKKALVRIKESVKG"
     MTREILGKKV GMTQIFDDEG EVIPVTVIEA GPCSIVQKKT EEKDGYKAIQ LGFGEAKESK        60
     LNKPLKGHFD KYGVEPKEYI REVRINEEDE YEVGDEIKAD IFAVGDRVDV TGTSKGKGFA       120
     GTVKRWNFNL GPKTHGSRNY RLPGSIGASA DPARVFKGKK MPGRMGREQV TIQNLKVAKV       180
     DPEKNILAVK GAVPGPKKAL VRIKESVKG                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page