(data stored in SCRATCH zone)

EMBL: CP002105.PE176

CP002105.PE176       Location/Qualifiers
FT   CDS             187064..187600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0177"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="COGs: COG0097 Ribosomal protein L6P/L9E; InterPro
FT                   IPR020040:IPR019906:IPR000702; KEGG: hor:Hore_01320
FT                   ribosomal protein L6; PFAM: Ribosomal protein L6,
FT                   alpha-beta domain; SPTR: B8D0D9 50S ribosomal protein L6;
FT                   TIGRFAM: ribosomal protein L6; PFAM: Ribosomal protein L6;
FT                   TIGRFAM: ribosomal protein L6, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11728"
FT                   /db_xref="GOA:D9QTG4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTG4"
FT                   /protein_id="ADL11728.1"
FT                   /translation="MSRIGHLPIEIPDKVDITVDDNVITVKGPNGELSNKIDERLDVTL
FT                   DEDTITINRTGDSKEDRSIHGLNRSLVVNMVQGVTEGFKKELELNGVGYRVQKKGQNLE
FT                   LQVGYSHPVVIEAQDGIKLEIEGNDKIIVSGADKQKVGEVAANIRSVREPEPYGGKGIK
FT                   YVDEHIRRKEGKTAG"
     MSRIGHLPIE IPDKVDITVD DNVITVKGPN GELSNKIDER LDVTLDEDTI TINRTGDSKE        60
     DRSIHGLNRS LVVNMVQGVT EGFKKELELN GVGYRVQKKG QNLELQVGYS HPVVIEAQDG       120
     IKLEIEGNDK IIVSGADKQK VGEVAANIRS VREPEPYGGK GIKYVDEHIR RKEGKTAG         178
//

If you have problems or comments...

PBIL Back to PBIL home page