(data stored in SCRATCH zone)

EMBL: CP002105.PE177

CP002105.PE177       Location/Qualifiers
FT   CDS             187632..187982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0178"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="COGs: COG0256 Ribosomal protein L18; InterPro
FT                   IPR005484:IPR004389; KEGG: hor:Hore_01330 ribosomal protein
FT                   L18; PFAM: ribosomal protein L18P/L5E; SPTR: B8D0E0
FT                   Ribosomal protein L18; TIGRFAM: ribosomal protein L18;
FT                   PFAM: Ribosomal L18p/L5e family; TIGRFAM: ribosomal protein
FT                   L18, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11729"
FT                   /db_xref="GOA:D9QTG5"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTG5"
FT                   /protein_id="ADL11729.1"
FT                   /translation="MSTSRKKRHQRIRNKISGTPFKPRLSVYRSLKHIYAQLIDDLSGE
FT                   TLAAASTQDPEIRDEIDNGGNVEAAQMVGELIAERALKEDIKEVVFDRGGNKYHGRVKA
FT                   LAEAARENGLEF"
     MSTSRKKRHQ RIRNKISGTP FKPRLSVYRS LKHIYAQLID DLSGETLAAA STQDPEIRDE        60
     IDNGGNVEAA QMVGELIAER ALKEDIKEVV FDRGGNKYHG RVKALAEAAR ENGLEF           116
//

If you have problems or comments...

PBIL Back to PBIL home page