(data stored in SCRATCH zone)

EMBL: CP002105.PE178

CP002105.PE178       Location/Qualifiers
FT   CDS             188001..188513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0179"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="COGs: COG0098 Ribosomal protein S5;
FT                   InterProIPR013810:IPR005324:IPR014720:IPR014721:IPR
FT                   020568:IPR005712; KEGG: hor:Hore_01340 ribosomal protein
FT                   S5; PFAM: Ribosomal protein S5 ; ribosomal protein S5
FT                   domain protein; SPTR: B8D0E1 Ribosomal protein S5; TIGRFAM:
FT                   ribosomal protein S5; PFAM: Ribosomal protein S5,
FT                   N-terminal domain; Ribosomal protein S5, C-terminal domain;
FT                   TIGRFAM: ribosomal protein S5, bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11730"
FT                   /db_xref="GOA:D9QTG6"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTG6"
FT                   /protein_id="ADL11730.1"
FT                   /translation="MAIKKNMIDPDELELDERVVNINRVSKVVKGGRRFSFSSLVIVGD
FT                   GNGHVGAGIGKANEVPGAIQKGIAAAKKELIEVPLDDTTIPHEVTGVFGAGRVLFKPAS
FT                   EGTGIIAGGPIRAVVELAGIKDILTKSLGSDNPLNMVNAAIQGLKEIKDVEKVAELRGK
FT                   SVEELLN"
     MAIKKNMIDP DELELDERVV NINRVSKVVK GGRRFSFSSL VIVGDGNGHV GAGIGKANEV        60
     PGAIQKGIAA AKKELIEVPL DDTTIPHEVT GVFGAGRVLF KPASEGTGII AGGPIRAVVE       120
     LAGIKDILTK SLGSDNPLNM VNAAIQGLKE IKDVEKVAEL RGKSVEELLN                  170
//

If you have problems or comments...

PBIL Back to PBIL home page