(data stored in SCRATCH zone)

EMBL: CP002105.PE180

CP002105.PE180       Location/Qualifiers
FT   CDS             189015..190274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0181"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="COGs: COG0201 Preprotein translocase subunit SecY;
FT                   InterPro IPR002208; KEGG: hor:Hore_01360 preprotein
FT                   translocase, SecY subunit; PFAM: SecY protein; SPTR: B8D0S8
FT                   Preprotein translocase secY subunit; TIGRFAM: preprotein
FT                   translocase, SecY subunit; PFAM: eubacterial secY protein;
FT                   TIGRFAM: preprotein translocase, SecY subunit; ATP synthase
FT                   subunit 6 (eukaryotes),also subunit A (prokaryotes)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11732"
FT                   /db_xref="GOA:D9QTG8"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTG8"
FT                   /protein_id="ADL11732.1"
FT                   /translation="MLSALTNSLKVKGLREKIFFILAMIAVYRIGAHIPVPGVDPSRLS
FT                   ELFQQGGLLGFLDMFSGGALRRFTIFAMSINPYITASIIMQLLTVVIPRLEELSKQGQE
FT                   GKKVIAQYTRYATVVLALIQGFGITLWIKNLGAIANPTYFTLFTIIITLTAGTAFLMWL
FT                   GEQITDKGIGNGISIIIFASVISRAPSAVIGIVRKLQVGAISIFNVFFFLIIAVVIVAA
FT                   IIYIQQGERKIPVQYSKRVVGRKVYGGQSTHIPLKVNQAGVIPVIFASSVLLFPATIAK
FT                   ILPYGWAQSLADALSPGSALYTALYALLIIFFTYFYTAIQFNPREVADNIKQNGGFVPG
FT                   RRPGRPTAEYLDRILTRITLAGAIFLAAVAVLPNFVMSITGIEVRFGGTALLIVIGVAL
FT                   QTMKEIETQLLQRHYQGFME"
     MLSALTNSLK VKGLREKIFF ILAMIAVYRI GAHIPVPGVD PSRLSELFQQ GGLLGFLDMF        60
     SGGALRRFTI FAMSINPYIT ASIIMQLLTV VIPRLEELSK QGQEGKKVIA QYTRYATVVL       120
     ALIQGFGITL WIKNLGAIAN PTYFTLFTII ITLTAGTAFL MWLGEQITDK GIGNGISIII       180
     FASVISRAPS AVIGIVRKLQ VGAISIFNVF FFLIIAVVIV AAIIYIQQGE RKIPVQYSKR       240
     VVGRKVYGGQ STHIPLKVNQ AGVIPVIFAS SVLLFPATIA KILPYGWAQS LADALSPGSA       300
     LYTALYALLI IFFTYFYTAI QFNPREVADN IKQNGGFVPG RRPGRPTAEY LDRILTRITL       360
     AGAIFLAAVA VLPNFVMSIT GIEVRFGGTA LLIVIGVALQ TMKEIETQLL QRHYQGFME        419
//

If you have problems or comments...

PBIL Back to PBIL home page