(data stored in SCRATCH zone)

EMBL: CP002105.PE198

CP002105.PE198       Location/Qualifiers
FT   CDS             202470..203459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0199"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterPro IPR007197:IPR013785:IPR006638:IPR016431;
FT                   KEGG: mta:Moth_2294 radical SAM family protein; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: Q2RG58 Radical SAM; PFAM: Radical SAM
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11750"
FT                   /db_xref="GOA:D9QTI6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTI6"
FT                   /protein_id="ADL11750.1"
FT                   /translation="MKEARWYERLDEEEIRCNLCPHSCLITAGQTGICQARENQEGRLV
FT                   SKTYGQVSAVAVDPIEKKPLFHFYPGSEILSLGTVGCNLRCQFCQNYHIAHNQEAETRR
FT                   LEPEEIVTLVKKHNSIGAAYTYSEPLIWYEYILDTAQLIHQTGLKNVLVTNGLINPEPL
FT                   AGLLSYIDGLNIDLKAFSEEFYRDICQGYLEPVKESIRLANQEALVEVTTLLIPGLNDS
FT                   REEIEELTAWLADINPDIPLHFTRYFPKYKLQAEQTSMETLLQAKEIAEEKLNFVYLGN
FT                   VREPEYSNTYCYECGQLLIKRSWSQPEIYLQDDICPECGAEINILLAD"
     MKEARWYERL DEEEIRCNLC PHSCLITAGQ TGICQARENQ EGRLVSKTYG QVSAVAVDPI        60
     EKKPLFHFYP GSEILSLGTV GCNLRCQFCQ NYHIAHNQEA ETRRLEPEEI VTLVKKHNSI       120
     GAAYTYSEPL IWYEYILDTA QLIHQTGLKN VLVTNGLINP EPLAGLLSYI DGLNIDLKAF       180
     SEEFYRDICQ GYLEPVKESI RLANQEALVE VTTLLIPGLN DSREEIEELT AWLADINPDI       240
     PLHFTRYFPK YKLQAEQTSM ETLLQAKEIA EEKLNFVYLG NVREPEYSNT YCYECGQLLI       300
     KRSWSQPEIY LQDDICPECG AEINILLAD                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page