(data stored in SCRATCH zone)

EMBL: CP002105.PE2

CP002105.PE2         Location/Qualifiers
FT   CDS             1966..3063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: amt:Amet_0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: A6TJ77 DNA polymerase III,
FT                   beta subunit; TIGRFAM: DNA polymerase III, beta subunit;
FT                   PFAM: DNA polymerase III beta subunit, C-terminal domain;
FT                   DNA polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11554"
FT                   /db_xref="GOA:D9QS98"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D9QS98"
FT                   /protein_id="ADL11554.1"
FT                   /translation="MQIKIDRKNFYDGIQTVRKAISSKSTLPILSGILIETQEKKLKLV
FT                   GTDLELGIECRVDANIIKDGAIVLPANHLANIVRELPNKELELELKKDNKIEISCGLSQ
FT                   FKIHGSPADEYPLLPEVGSGIEYTLSQEKFQAMINRIKFATSDDESRPFLTGGLLSIDN
FT                   ENLKMVATDSYRLAYTQLELDKDLKNEKIIIPSKTLNELSKLLNSEDEIRFLITDNQIL
FT                   FEFSEITIISRLIEGQFPNYKQVIPDNHKTEIKLKKKELLNATKRSALVARNNSNIIKT
FT                   KFQNDKLMIESNAPEVGQAYEELSTSQHGDDTEIAFNANYLIDVLKVIDNEEILIELSG
FT                   ELSPGVIKEVDNDNYIHVIMPVRST"
     MQIKIDRKNF YDGIQTVRKA ISSKSTLPIL SGILIETQEK KLKLVGTDLE LGIECRVDAN        60
     IIKDGAIVLP ANHLANIVRE LPNKELELEL KKDNKIEISC GLSQFKIHGS PADEYPLLPE       120
     VGSGIEYTLS QEKFQAMINR IKFATSDDES RPFLTGGLLS IDNENLKMVA TDSYRLAYTQ       180
     LELDKDLKNE KIIIPSKTLN ELSKLLNSED EIRFLITDNQ ILFEFSEITI ISRLIEGQFP       240
     NYKQVIPDNH KTEIKLKKKE LLNATKRSAL VARNNSNIIK TKFQNDKLMI ESNAPEVGQA       300
     YEELSTSQHG DDTEIAFNAN YLIDVLKVID NEEILIELSG ELSPGVIKEV DNDNYIHVIM       360
     PVRST                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page