(data stored in SCRATCH zone)

EMBL: CP002105.PE20

CP002105.PE20        Location/Qualifiers
FT   CDS             24920..25168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11572"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSB6"
FT                   /protein_id="ADL11572.1"
FT                   /translation="MTMTDGGYEDFEDFMQNRLSNNDSNSAKQSLGGEDSMNETELEGE
FT                   ERPESRKRKKGKCSKNCGQIIIEKVEELEIEIDCCTD"
     MTMTDGGYED FEDFMQNRLS NNDSNSAKQS LGGEDSMNET ELEGEERPES RKRKKGKCSK        60
     NCGQIIIEKV EELEIEIDCC TD                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page