(data stored in SCRATCH zone)

EMBL: CP002105.PE202

CP002105.PE202       Location/Qualifiers
FT   CDS             206604..209474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0203"
FT                   /product="glycerol 3-phosphate dehydrogenase (quinone)
FT                   subunit C"
FT                   /EC_number="1.1.5.3"
FT                   /note="COGs: COG0277 FAD/FMN-containing dehydrogenase;
FT                   InterProIPR006094:IPR004113:IPR004017:IPR016167:IPR
FT                   012285:IPR016166:IPR016164:IPR009051:IPR017753; KEGG:
FT                   hma:rrnAC1967 glycolate oxidase subunit GlcD; PFAM: FAD
FT                   linked oxidase domain protein; protein of unknown function
FT                   DUF224 cysteine-rich region domain protein; SPTR: C1SJH5
FT                   FAD/FMN-dependent dehydrogenase; TIGRFAM:
FT                   glycerol-3-phosphate dehydrogenase, anaerobic, C subunit;
FT                   PFAM: Cysteine-rich domain; FAD binding domain; FAD linked
FT                   oxidases, C-terminal domain; TIGRFAM: glycerol-3-phosphate
FT                   dehydrogenase, anaerobic, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11754"
FT                   /db_xref="GOA:D9QTJ0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTJ0"
FT                   /protein_id="ADL11754.1"
FT                   /translation="MTNLKLEEQMDELNSLIDGEVLTDETNRILYSTDASIYQIEPLGV
FT                   VLPKNKSDVQKAVEYASNNGLSIIPRGAGSGLSGQTLGQGIVIDFTKYMDRIKEINIEE
FT                   SYVRLEPGVTLGVLNQTLSQDNKFLPPDPSSGNYCTLGGMLGNNASGGHSVKYGSTIDY
FT                   VLELEVVLADGEEIKVENLEIGSQQFKAKLNQSNKVGDIYQQILELVKNNKELIAEHTP
FT                   DARKNCSGYRLDEVLADQQFNLAKLLVGSEGTLAVITEAKLRIAELPSEQAIALLYFDD
FT                   LDKAGRAVDKVLELDPSAIEIMNYGFLELVRKNHADIDQRLPDDLKTALLIEFDGDSQS
FT                   EIEEKILQTEELICDELGLAFEIDTAHEEAEQKKLWSVRKSAVPILNKLEGPKRITGFV
FT                   EDVAVAPAKLPDYIRRFKEIMDKYEVEAIIYGHAGHGNTHPRPLLNLKQEEDIEKMEAI
FT                   AQDVYELVNELNGTISGEHGDGLLRTDFIEEIYGSMYDLFQKTKEIFDPEYILNPGKIV
FT                   VDTTDLLTENLRYGADYETIGVESDLEFATEYQKEVEKCHGCSKCRSVVGTDMCPVFKA
FT                   LGEEKAAPRAKANILRGLISGRLDYNEYLKSRAFQEVFDLCLNCKNCYLECSSEVNIPK
FT                   LIMEARIQHYRQTGQPLVNRFLGASEVLGKLGSITPKLTNTFLDAAPLRGMMEKMTGIA
FT                   KKRSLPEFTDNTFKEWFAGRENKADKKVAYFVGCSTNYYHPEVGKGLVQLLEANGYQVI
FT                   IPDQKCCSVANLNYGNLEGVQENINYNLESLVEVVKEGYDIVADCPSCSLMLKEEQLDV
FT                   VDTKEARLVAENTYHINEYLLNLKEKDELKLDFNPNEIDFLYHTPCHLKAQGLASSTEE
FT                   LLGFIPELEIKELDAGCCGIAGTFGLKKDKYDLSMEIGENLFKKIESSNLEKVLTDCDA
FT                   CRMQLEEGTGKAVRHPIEILAENLSD"
     MTNLKLEEQM DELNSLIDGE VLTDETNRIL YSTDASIYQI EPLGVVLPKN KSDVQKAVEY        60
     ASNNGLSIIP RGAGSGLSGQ TLGQGIVIDF TKYMDRIKEI NIEESYVRLE PGVTLGVLNQ       120
     TLSQDNKFLP PDPSSGNYCT LGGMLGNNAS GGHSVKYGST IDYVLELEVV LADGEEIKVE       180
     NLEIGSQQFK AKLNQSNKVG DIYQQILELV KNNKELIAEH TPDARKNCSG YRLDEVLADQ       240
     QFNLAKLLVG SEGTLAVITE AKLRIAELPS EQAIALLYFD DLDKAGRAVD KVLELDPSAI       300
     EIMNYGFLEL VRKNHADIDQ RLPDDLKTAL LIEFDGDSQS EIEEKILQTE ELICDELGLA       360
     FEIDTAHEEA EQKKLWSVRK SAVPILNKLE GPKRITGFVE DVAVAPAKLP DYIRRFKEIM       420
     DKYEVEAIIY GHAGHGNTHP RPLLNLKQEE DIEKMEAIAQ DVYELVNELN GTISGEHGDG       480
     LLRTDFIEEI YGSMYDLFQK TKEIFDPEYI LNPGKIVVDT TDLLTENLRY GADYETIGVE       540
     SDLEFATEYQ KEVEKCHGCS KCRSVVGTDM CPVFKALGEE KAAPRAKANI LRGLISGRLD       600
     YNEYLKSRAF QEVFDLCLNC KNCYLECSSE VNIPKLIMEA RIQHYRQTGQ PLVNRFLGAS       660
     EVLGKLGSIT PKLTNTFLDA APLRGMMEKM TGIAKKRSLP EFTDNTFKEW FAGRENKADK       720
     KVAYFVGCST NYYHPEVGKG LVQLLEANGY QVIIPDQKCC SVANLNYGNL EGVQENINYN       780
     LESLVEVVKE GYDIVADCPS CSLMLKEEQL DVVDTKEARL VAENTYHINE YLLNLKEKDE       840
     LKLDFNPNEI DFLYHTPCHL KAQGLASSTE ELLGFIPELE IKELDAGCCG IAGTFGLKKD       900
     KYDLSMEIGE NLFKKIESSN LEKVLTDCDA CRMQLEEGTG KAVRHPIEIL AENLSD           956
//

If you have problems or comments...

PBIL Back to PBIL home page