(data stored in SCRATCH zone)

EMBL: CP002105.PE21

CP002105.PE21        Location/Qualifiers
FT   CDS             25304..25636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hor:Hore_04100 hypothetical protein; SPTR:
FT                   B8D1U1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11573"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSB7"
FT                   /protein_id="ADL11573.1"
FT                   /translation="MFSLINRIKEKIGSLFKRTDCRNKDEIHLNLDGLEIIMERCFAYD
FT                   KPHEVSVFVPRAELRKKMDDGEKTEEIEILLNSITVVHSPQRPSDEGEGSPPEPPEIPQ
FT                   DDVDNM"
     MFSLINRIKE KIGSLFKRTD CRNKDEIHLN LDGLEIIMER CFAYDKPHEV SVFVPRAELR        60
     KKMDDGEKTE EIEILLNSIT VVHSPQRPSD EGEGSPPEPP EIPQDDVDNM                  110
//

If you have problems or comments...

PBIL Back to PBIL home page