(data stored in SCRATCH zone)

EMBL: CP002105.PE211

CP002105.PE211       Location/Qualifiers
FT   CDS             219606..221183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0212"
FT                   /product="(R)-citramalate synthase"
FT                   /note="COGs: COG0119
FT                   Isopropylmalate/homocitrate/citramalate synthase;
FT                   InterProIPR002034:IPR000891:IPR013709:IPR013785:IPR 005675;
FT                   KEGG: pfu:PF0941 putative alpha-isopropylmalate/homocitrate
FT                   synthase family transferase; PFAM: LeuA allosteric
FT                   (dimerisation) domain; pyruvate carboxyltransferase; SPTR:
FT                   Q8U298 Leua homolog alpha-isopropylmalate synthase related;
FT                   TIGRFAM: 2-isopropylmalate synthase/homocitrate synthase
FT                   family protein; PFAM: HMGL-like; LeuA allosteric
FT                   (dimerisation) domain; TIGRFAM: 2-isopropylmalate
FT                   synthase/homocitrate synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11763"
FT                   /db_xref="GOA:D9QTJ9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTJ9"
FT                   /protein_id="ADL11763.1"
FT                   /translation="MCLKMVELYDTTLRDGTQREGISYSTEDKLRITKKLDKLGIDYIE
FT                   GGWPGSNPKDIEYFQQVQKLSLTNATVAAFGSTRRPGIEAKEDSNLEEIITSGVEIATI
FT                   VGKSWDFHVIEALETELEENLAMIEETISYLKSNGLQVFYDAEHFFDAYKSNTEYAIET
FT                   IQAADRAGADRIILCDTNGGTLPLELREIIEKVKDKVDTSLGIHAHNDSEVAVANSLLA
FT                   VKSGVVQVQGTINGYGERCGNANLSSIIPNLKLKQGIDSVTEEQLKRLTGVSRFVSEVA
FT                   NLTPPTHKPYVGDSAFAHKGGIHVSALMKDPETYEHLAPETVGNRRKVLVSELSGKSNL
FT                   MYKAEEYGIEIDKENGDLKQALEKIKELEHQGYQFEGAKASFEILMKKATNSYEKLFEL
FT                   EGCRIITEKASGLTPLSEATIKVKVNGQIVHTAAEGEGPVNALDNALRKALLEFYPALE
FT                   EIYLIDYKVRVLDGNDGTSAKVRVLIESGNGHESWGTVGASTNIIEASWQALVDSIEYG
FT                   IKLSQDKE"
     MCLKMVELYD TTLRDGTQRE GISYSTEDKL RITKKLDKLG IDYIEGGWPG SNPKDIEYFQ        60
     QVQKLSLTNA TVAAFGSTRR PGIEAKEDSN LEEIITSGVE IATIVGKSWD FHVIEALETE       120
     LEENLAMIEE TISYLKSNGL QVFYDAEHFF DAYKSNTEYA IETIQAADRA GADRIILCDT       180
     NGGTLPLELR EIIEKVKDKV DTSLGIHAHN DSEVAVANSL LAVKSGVVQV QGTINGYGER       240
     CGNANLSSII PNLKLKQGID SVTEEQLKRL TGVSRFVSEV ANLTPPTHKP YVGDSAFAHK       300
     GGIHVSALMK DPETYEHLAP ETVGNRRKVL VSELSGKSNL MYKAEEYGIE IDKENGDLKQ       360
     ALEKIKELEH QGYQFEGAKA SFEILMKKAT NSYEKLFELE GCRIITEKAS GLTPLSEATI       420
     KVKVNGQIVH TAAEGEGPVN ALDNALRKAL LEFYPALEEI YLIDYKVRVL DGNDGTSAKV       480
     RVLIESGNGH ESWGTVGAST NIIEASWQAL VDSIEYGIKL SQDKE                       525
//

If you have problems or comments...

PBIL Back to PBIL home page