(data stored in SCRATCH zone)

EMBL: CP002105.PE214

CP002105.PE214       Location/Qualifiers
FT   CDS             complement(223583..224818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0215"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="COGs: COG0675 Transposase and inactivated
FT                   derivatives; InterPro IPR001959:IPR010095; KEGG:
FT                   tna:CTN_1813 transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB; putative transposase
FT                   IS891/IS1136/IS1341 family; SPTR: B9KAK6 Transposase, IS605
FT                   OrfB family; TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   Putative transposase DNA-binding domain; Probable
FT                   transposase; TIGRFAM: transposase, IS605 OrfB family,
FT                   central region"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11766"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTK2"
FT                   /protein_id="ADL11766.1"
FT                   /translation="MNKTYILPINQQELAKQLSRQSGRIYSKVVSTIFKLKQNKNIWLS
FT                   KNGMEKLIKLYASEFRLHSQTKQGIVQQYYNNLKSFFNAKENQENAKPPYKTRKYNKVI
FT                   YKRSAIKLKDNGVLRLSNGRKGKAIKVKAPSLTKKPKYAELIYHHNEDKYKLHITVEVK
FT                   NKKIDYDNDKVLAIDLGQKHPMVTYNNQTKESIIYNGGRLNSFIRFRNKELAKLQEKMS
FT                   RCQKYSNRWKKLNRAKKKLLSKSKNKIMDVLKKYASHLISFCLKREISTIVIGDLKGIR
FT                   EKINFGTKDNQKMHQWLFGQLIDIIKYQAKAIGIKVKFIDESYTSQTCPQCGYQHKPSD
FT                   RNFDCPNCNVSFHRDFVGAFNIYKKYTRGSLDKSSRLEGVLTSSYGVKYDSNSISCLTN
FT                   WNTSPFGQGIPA"
     MNKTYILPIN QQELAKQLSR QSGRIYSKVV STIFKLKQNK NIWLSKNGME KLIKLYASEF        60
     RLHSQTKQGI VQQYYNNLKS FFNAKENQEN AKPPYKTRKY NKVIYKRSAI KLKDNGVLRL       120
     SNGRKGKAIK VKAPSLTKKP KYAELIYHHN EDKYKLHITV EVKNKKIDYD NDKVLAIDLG       180
     QKHPMVTYNN QTKESIIYNG GRLNSFIRFR NKELAKLQEK MSRCQKYSNR WKKLNRAKKK       240
     LLSKSKNKIM DVLKKYASHL ISFCLKREIS TIVIGDLKGI REKINFGTKD NQKMHQWLFG       300
     QLIDIIKYQA KAIGIKVKFI DESYTSQTCP QCGYQHKPSD RNFDCPNCNV SFHRDFVGAF       360
     NIYKKYTRGS LDKSSRLEGV LTSSYGVKYD SNSISCLTNW NTSPFGQGIP A                411
//

If you have problems or comments...

PBIL Back to PBIL home page