(data stored in SCRATCH zone)

EMBL: CP002105.PE223

CP002105.PE223       Location/Qualifiers
FT   CDS             complement(233310..233585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0224"
FT                   /product="uncharacterized protein family (UPF0180)"
FT                   /note="KEGG: hor:Hore_00370 uncharacterized protein family
FT                   (UPF0180); SPTR: B8D044 Uncharacterized protein family
FT                   (UPF0180); PFAM: Uncharacterised protein family (UPF0180)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11775"
FT                   /db_xref="InterPro:IPR005370"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTL1"
FT                   /protein_id="ADL11775.1"
FT                   /translation="MKNKGKKKVAVEEGLSEVAQELKKSGFEVATLGANATAKGDTDTT
FT                   QKADAVIVNGQNQEAVKTANEIQGKVINAKNLSPNQVKEEVKNKVK"
     MKNKGKKKVA VEEGLSEVAQ ELKKSGFEVA TLGANATAKG DTDTTQKADA VIVNGQNQEA        60
     VKTANEIQGK VINAKNLSPN QVKEEVKNKV K                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page