(data stored in SCRATCH zone)

EMBL: CP002105.PE224

CP002105.PE224       Location/Qualifiers
FT   CDS             233759..235705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0225"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004010:IPR003660:IPR004089:IPR004090; KEGG:
FT                   bbe:BBR47_16050 probable methyl-accepting chemotaxis
FT                   protein; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; Cache domain protein;
FT                   SMART: chemotaxis sensory transducer; histidine kinase HAMP
FT                   region domain protein; SPTR: C0Z9B2 Probable
FT                   methyl-accepting chemotaxis protein; PFAM: Cache domain;
FT                   HAMP domain; Methyl-accepting chemotaxis protein (MCP)
FT                   signaling domain; Tar ligand binding domain homologue"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11776"
FT                   /db_xref="GOA:D9QTL2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTL2"
FT                   /protein_id="ADL11776.1"
FT                   /translation="MGKICQFFNNSIRNRLIILLLVIGLVPVAVMSYFQVTETKETLED
FT                   NFVDSTTKEIKQVDNAINLYFDTVKRNCEMLAADSTVQQADESITSYLNKTKEENLNLT
FT                   PVENGGVETEIYKEYLHFAETHPNAAYVYMATTDGGYIQWPANSVPKNYNPAERSYYKE
FT                   AMQNKDQVIRTSPYYWSADDAVIVSTATTIEDDTGEIIGVQGLDVSLKGLTEMVKNISV
FT                   GDTGYIIMTTADGTILAHPKKPELNFKNIEKLGINKLNNISQIEDKEFTTAMDGREYLM
FT                   NLYTSSETGWKFIAVIEKSEIDSQIGALYRKIGLIALICVVIIIIAAGIISKRFTQPIT
FT                   AATRFAKEIAKGNLNAAPLESNSQDEVADLIQALEKMRHKLKDMLTSLVDTIEDLSAYS
FT                   QELSASSQEGNAVIEQNTENIEEMASSIQEISASSQEVTGLAQETDSQAEEGKEKIDEL
FT                   TNVEKVNRVVNNAVESIQELNANSKEIGKIVELISDIAEQTNLLALNAAIEAARAGEDG
FT                   RGFAVVAEEIRELAEETNQATAEIAELIQDTQNKSQVSLEAVQQMENKVQDRKEFLRET
FT                   NEAFTKIKQKIEDTSAHIQQTAASAQNLAENSEQMQQASEDMRNMSQEVTNSSQELAKM
FT                   AQELQEVVEQFNI"
     MGKICQFFNN SIRNRLIILL LVIGLVPVAV MSYFQVTETK ETLEDNFVDS TTKEIKQVDN        60
     AINLYFDTVK RNCEMLAADS TVQQADESIT SYLNKTKEEN LNLTPVENGG VETEIYKEYL       120
     HFAETHPNAA YVYMATTDGG YIQWPANSVP KNYNPAERSY YKEAMQNKDQ VIRTSPYYWS       180
     ADDAVIVSTA TTIEDDTGEI IGVQGLDVSL KGLTEMVKNI SVGDTGYIIM TTADGTILAH       240
     PKKPELNFKN IEKLGINKLN NISQIEDKEF TTAMDGREYL MNLYTSSETG WKFIAVIEKS       300
     EIDSQIGALY RKIGLIALIC VVIIIIAAGI ISKRFTQPIT AATRFAKEIA KGNLNAAPLE       360
     SNSQDEVADL IQALEKMRHK LKDMLTSLVD TIEDLSAYSQ ELSASSQEGN AVIEQNTENI       420
     EEMASSIQEI SASSQEVTGL AQETDSQAEE GKEKIDELTN VEKVNRVVNN AVESIQELNA       480
     NSKEIGKIVE LISDIAEQTN LLALNAAIEA ARAGEDGRGF AVVAEEIREL AEETNQATAE       540
     IAELIQDTQN KSQVSLEAVQ QMENKVQDRK EFLRETNEAF TKIKQKIEDT SAHIQQTAAS       600
     AQNLAENSEQ MQQASEDMRN MSQEVTNSSQ ELAKMAQELQ EVVEQFNI                    648
//

If you have problems or comments...

PBIL Back to PBIL home page