(data stored in SCRATCH zone)

EMBL: CP002105.PE231

CP002105.PE231       Location/Qualifiers
FT   CDS             243284..244120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0233"
FT                   /product="Flp pilus assembly protein CpaB"
FT                   /note="COGs: COG3745 Flp pilus assembly protein CpaB;
FT                   InterPro IPR013974:IPR017592; KEGG: pth:PTH_1449 flp pilus
FT                   assembly protein CpaB; PFAM: SAF domain protein; SPTR:
FT                   A5D2B5 Flp pilus assembly protein CpaB; TIGRFAM: Flp pilus
FT                   assembly protein CpaB; PFAM: SAF domain; TIGRFAM: Flp pilus
FT                   assembly protein CpaB"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11783"
FT                   /db_xref="GOA:D9QTL9"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTL9"
FT                   /protein_id="ADL11783.1"
FT                   /translation="MNFKVVIVIAVILGLITSGAVYFMMDNMQQEAVKEQPKASVVVAK
FT                   QNIEPREQITRSKVQLKQVPQETVHSQAVTSISQAVEKFALKDIISGEQLLKPRLLGKE
FT                   EVSSGLAFNLADDKRAVTVPVTEVSGVAGFLTPGDYVDVVSVFSTYEAQQTVAKTVLQK
FT                   VKVLAVAQDMVRERDQKPKVTKSVTLGVGLAEAEKLVLADRKGEIRLVLRSAQNESFSM
FT                   SNGVKFEELVGNLEEEGTDNKEQIADKDINQKSSSQDQEGIEVIRGSERSYQKVSP"
     MNFKVVIVIA VILGLITSGA VYFMMDNMQQ EAVKEQPKAS VVVAKQNIEP REQITRSKVQ        60
     LKQVPQETVH SQAVTSISQA VEKFALKDII SGEQLLKPRL LGKEEVSSGL AFNLADDKRA       120
     VTVPVTEVSG VAGFLTPGDY VDVVSVFSTY EAQQTVAKTV LQKVKVLAVA QDMVRERDQK       180
     PKVTKSVTLG VGLAEAEKLV LADRKGEIRL VLRSAQNESF SMSNGVKFEE LVGNLEEEGT       240
     DNKEQIADKD INQKSSSQDQ EGIEVIRGSE RSYQKVSP                               278
//

If you have problems or comments...

PBIL Back to PBIL home page