(data stored in SCRATCH zone)

EMBL: CP002105.PE237

CP002105.PE237       Location/Qualifiers
FT   CDS             249937..250281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0239"
FT                   /product="protein of unknown function DUF192"
FT                   /note="InterPro IPR003795; KEGG: drm:Dred_2119 hypothetical
FT                   protein; PFAM: protein of unknown function DUF192; SPTR:
FT                   A4J6D3 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized ACR, COG1430"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11789"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTM5"
FT                   /protein_id="ADL11789.1"
FT                   /translation="MKLINRSKDIEIIGKLSKATTFWQRLVGLLGKEDISLDEGLLITP
FT                   CKIVHTFFMEFSLDLIFLDDDNRVVKLVTCLQPNRISPVVFSAVKVIELKARTDLETLV
FT                   EEGDRLIILD"
     MKLINRSKDI EIIGKLSKAT TFWQRLVGLL GKEDISLDEG LLITPCKIVH TFFMEFSLDL        60
     IFLDDDNRVV KLVTCLQPNR ISPVVFSAVK VIELKARTDL ETLVEEGDRL IILD             114
//

If you have problems or comments...

PBIL Back to PBIL home page