(data stored in SCRATCH zone)

EMBL: CP002105.PE248

CP002105.PE248       Location/Qualifiers
FT   CDS             261640..262074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0250"
FT                   /product="protein of unknown function DUF180"
FT                   /note="COGs: COG1699 conserved hypothetical protein;
FT                   InterPro IPR003775; KEGG: csc:Csac_1670 flagellar assembly
FT                   protein FliW; PFAM: protein of unknown function DUF180;
FT                   SPTR: A4XK25 Flagellar assembly factor fliW; PFAM: FliW
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11800"
FT                   /db_xref="GOA:D9QTN6"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTN6"
FT                   /protein_id="ADL11800.1"
FT                   /translation="MELETTRFGKLEVDEEEIITFEDGLYGFEDNKRFTLVADEEPFFW
FT                   LQSMTDPDLAFVIVEPGVFCQDYEFSLNDKVKDELQLESKAEVLVMNIVVVPENPKEMT
FT                   MNLKAPIIINEKKRIAKQIILEEEEYPVKYRLFEEESISA"
     MELETTRFGK LEVDEEEIIT FEDGLYGFED NKRFTLVADE EPFFWLQSMT DPDLAFVIVE        60
     PGVFCQDYEF SLNDKVKDEL QLESKAEVLV MNIVVVPENP KEMTMNLKAP IIINEKKRIA       120
     KQIILEEEEY PVKYRLFEEE SISA                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page