(data stored in SCRATCH zone)

EMBL: CP002105.PE252

CP002105.PE252       Location/Qualifiers
FT   CDS             265961..268264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0254"
FT                   /product="glycosyl transferase family 2"
FT                   /note="InterProIPR001173:IPR001440:IPR011990:IPR019734:IPR
FT                   013026; KEGG: cdf:CD0240 putative glycosyltransferase;
FT                   PFAM: glycosyl transferase family 2; TPR repeat-containing
FT                   protein; SPTR: Q18CX6 Putative glycosyltransferase; PFAM:
FT                   Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11804"
FT                   /db_xref="GOA:D9QTP0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTP0"
FT                   /protein_id="ADL11804.1"
FT                   /translation="MKLSIGMMVKNEAKYLEECLKSLQPIREAIESELVIVDTGSDDGT
FT                   VEIAKQFTDKVYFHEWNDHFSEMRNTVISYTKGDWYFSIDGDEVVENPEGFIHFFQSGK
FT                   YKEFNSALVTQKNYINKEKTNVSNLLVPRVFKNDEDFHFEGAIHNQPVVKKPVCTLDTV
FT                   LEHYGYLQNDQELMERKFNRTSNILKRELENDPENIYYRFQLANSYGMHGDYDKAIENI
FT                   EKTYEVVNQKKTDLSSYLYIHNLMAKMYLGQNRLSEAEKICKEAIGLAKGYYSDLYYYL
FT                   GKAQLKLNKNEEAIENFKIYLDIVEKDGPLEQINDTSFIFYTEDNLEQAYLFLLVLYER
FT                   IEDYEQIINVSYKIKSKDNIKQVIPKAIKACVETDRFNEIKNYYQNKILTEFKDLSGKY
FT                   LAELESKMMTMNKEKKYNIFNVFSVEKSSYGILNKVRLRELKDNKLVNLITKMNFNSLP
FT                   NYYGDIIYYLLQNKYFLVDVCGVIQEQRLNKFLQYVLDDNKEENISSVLYEYLENRFNV
FT                   ETLSHLNINKVLERYILVLDDLNNEKYFNIFRRYIEDGTKYIKMVYSDEIIQNEMTQFV
FT                   KNDEEVFLLYIYLANQHKENNPKKYVRYLRKSLDAFPAMKKGIQMLLERFEKKDTLNGG
FT                   LENYQEKIKNNIDKLINNGNLKKAEELINEYEDTIEDDAEIYSMKSVIAIMKNNFKKAK
FT                   KIIKNGLEIEPDNFDLLYNLGYVYEELNQYNQAKDYYLQAKNSINSSKQKDDLAQALKR
FT                   IEEKTKEVEEKYGL"
     MKLSIGMMVK NEAKYLEECL KSLQPIREAI ESELVIVDTG SDDGTVEIAK QFTDKVYFHE        60
     WNDHFSEMRN TVISYTKGDW YFSIDGDEVV ENPEGFIHFF QSGKYKEFNS ALVTQKNYIN       120
     KEKTNVSNLL VPRVFKNDED FHFEGAIHNQ PVVKKPVCTL DTVLEHYGYL QNDQELMERK       180
     FNRTSNILKR ELENDPENIY YRFQLANSYG MHGDYDKAIE NIEKTYEVVN QKKTDLSSYL       240
     YIHNLMAKMY LGQNRLSEAE KICKEAIGLA KGYYSDLYYY LGKAQLKLNK NEEAIENFKI       300
     YLDIVEKDGP LEQINDTSFI FYTEDNLEQA YLFLLVLYER IEDYEQIINV SYKIKSKDNI       360
     KQVIPKAIKA CVETDRFNEI KNYYQNKILT EFKDLSGKYL AELESKMMTM NKEKKYNIFN       420
     VFSVEKSSYG ILNKVRLREL KDNKLVNLIT KMNFNSLPNY YGDIIYYLLQ NKYFLVDVCG       480
     VIQEQRLNKF LQYVLDDNKE ENISSVLYEY LENRFNVETL SHLNINKVLE RYILVLDDLN       540
     NEKYFNIFRR YIEDGTKYIK MVYSDEIIQN EMTQFVKNDE EVFLLYIYLA NQHKENNPKK       600
     YVRYLRKSLD AFPAMKKGIQ MLLERFEKKD TLNGGLENYQ EKIKNNIDKL INNGNLKKAE       660
     ELINEYEDTI EDDAEIYSMK SVIAIMKNNF KKAKKIIKNG LEIEPDNFDL LYNLGYVYEE       720
     LNQYNQAKDY YLQAKNSINS SKQKDDLAQA LKRIEEKTKE VEEKYGL                     767
//

If you have problems or comments...

PBIL Back to PBIL home page