(data stored in SCRATCH zone)

EMBL: CP002105.PE256

CP002105.PE256       Location/Qualifiers
FT   CDS             272884..273396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_0787 hypothetical protein; SPTR:
FT                   A6TLE4 Putative uncharacterized protein; PFAM: FlgN
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11808"
FT                   /db_xref="GOA:D9QTP4"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTP4"
FT                   /protein_id="ADL11808.1"
FT                   /translation="MKDNNDNLSIENLIKKLTNNYEEELNYYKEMLKLTNQQQQVIEDD
FT                   EWQSLNQLVSRKRELMKKVDELEKQILSYQEKISAELNLQIGDTFYPELCNKDLPGTKK
FT                   LKQVLINVYRLMQQIGELDKVNQARMEEKKKQKQQELNDVNQGLSVNRAYSGKSDSSEG
FT                   KFIDQNK"
     MKDNNDNLSI ENLIKKLTNN YEEELNYYKE MLKLTNQQQQ VIEDDEWQSL NQLVSRKREL        60
     MKKVDELEKQ ILSYQEKISA ELNLQIGDTF YPELCNKDLP GTKKLKQVLI NVYRLMQQIG       120
     ELDKVNQARM EEKKKQKQQE LNDVNQGLSV NRAYSGKSDS SEGKFIDQNK                  170
//

If you have problems or comments...

PBIL Back to PBIL home page