(data stored in SCRATCH zone)

EMBL: CP002105.PE257

CP002105.PE257       Location/Qualifiers
FT   CDS             273420..273995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hor:Hore_17050 hypothetical protein; SPTR:
FT                   B8CYT5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11809"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTP5"
FT                   /protein_id="ADL11809.1"
FT                   /translation="MEVYINEDQLEGVSGDIEEIISNVHSRLDREIVEQIYLNDMRVNE
FT                   DLLLSSDFEFDEESILKFETKEVNQLIEETLSEIDMYLPKLKEGVINTAQLFRQEKLEK
FT                   GRAKYESCLEGLEWYINVLQNILSLLDSEELTKQGEEILIEFNKRLRDVMKKMQIKDFD
FT                   SAADLLEDEIVDYIGQFNELNDKLTNVK"
     MEVYINEDQL EGVSGDIEEI ISNVHSRLDR EIVEQIYLND MRVNEDLLLS SDFEFDEESI        60
     LKFETKEVNQ LIEETLSEID MYLPKLKEGV INTAQLFRQE KLEKGRAKYE SCLEGLEWYI       120
     NVLQNILSLL DSEELTKQGE EILIEFNKRL RDVMKKMQIK DFDSAADLLE DEIVDYIGQF       180
     NELNDKLTNV K                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page