(data stored in SCRATCH zone)

EMBL: CP002105.PE262

CP002105.PE262       Location/Qualifiers
FT   CDS             280949..281767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0264"
FT                   /product="PP-loop domain protein"
FT                   /note="COGs: COG1606 ATP-utilizing protein of the PP-loop
FT                   superfamily; InterPro IPR011063:IPR014729:IPR005232; KEGG:
FT                   chy:CHY_1281 hypothetical protein; PFAM: PP-loop domain
FT                   protein; SPTR: Q3ACL9 Putative uncharacterized protein;
FT                   PFAM: Asparagine synthase; TIGRFAM: conserved hypothetical
FT                   protein TIGR00268"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11814"
FT                   /db_xref="GOA:D9QTQ0"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTQ0"
FT                   /protein_id="ADL11814.1"
FT                   /translation="MTSLEQKFTELKDILRSMDSLLVAFSGGVDSTLLLKVAHDILGDQ
FT                   AAALTVEASIHPPGEAEEAEELAQQMGVEHILVEADPLQNEDFARNDKLRCYYCKYNIF
FT                   SDLKEIAAKEGYAELADGANYDDFTGDYRPGLKAAEELGVRSPLKEAEITKEEVRKLSK
FT                   RLDLPTWDKPSLSCYATRFPYGSKITKQNLDLVAAAEEYLHQFGLKQLRVRHHDQATAR
FT                   IEVLPDDIEKLIEKRQEIVAKLKELGYTYVTLDLEGYRTGSLNEILDEEE"
     MTSLEQKFTE LKDILRSMDS LLVAFSGGVD STLLLKVAHD ILGDQAAALT VEASIHPPGE        60
     AEEAEELAQQ MGVEHILVEA DPLQNEDFAR NDKLRCYYCK YNIFSDLKEI AAKEGYAELA       120
     DGANYDDFTG DYRPGLKAAE ELGVRSPLKE AEITKEEVRK LSKRLDLPTW DKPSLSCYAT       180
     RFPYGSKITK QNLDLVAAAE EYLHQFGLKQ LRVRHHDQAT ARIEVLPDDI EKLIEKRQEI       240
     VAKLKELGYT YVTLDLEGYR TGSLNEILDE EE                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page