(data stored in SCRATCH zone)

EMBL: CP002105.PE263

CP002105.PE263       Location/Qualifiers
FT   CDS             282081..282827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0265"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /note="COGs: COG1691 NCAIR mutase (PurE)-related protein;
FT                   InterPro IPR000031; KEGG: dhd:Dhaf_2912
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; SPTR: Q24WP3 Putative uncharacterized protein;
FT                   PFAM: AIR carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11815"
FT                   /db_xref="GOA:D9QTQ1"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTQ1"
FT                   /protein_id="ADL11815.1"
FT                   /translation="MQPDRLKEILTKVEAGNLDVDTALEELKSPGYEDLGFAKVDQHRN
FT                   LRRGFPEVVLCEGKTEEQIVKIMQKLAETEENALATRADEDIYQAVKEELPEIEYNEAA
FT                   KTLVLQQTDLAEEGSILVISAGTSDIPVAEEAYETARIMGNSVERLYDVGVAGIHRLLE
FT                   NQKQLRQARVVIVAAGMEGALASVVGGLVDKPVIGVPTSVGYGASFEGVASLLGMLNSC
FT                   SAGVGVVNIDNGFGAAYLASSINKME"
     MQPDRLKEIL TKVEAGNLDV DTALEELKSP GYEDLGFAKV DQHRNLRRGF PEVVLCEGKT        60
     EEQIVKIMQK LAETEENALA TRADEDIYQA VKEELPEIEY NEAAKTLVLQ QTDLAEEGSI       120
     LVISAGTSDI PVAEEAYETA RIMGNSVERL YDVGVAGIHR LLENQKQLRQ ARVVIVAAGM       180
     EGALASVVGG LVDKPVIGVP TSVGYGASFE GVASLLGMLN SCSAGVGVVN IDNGFGAAYL       240
     ASSINKME                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page