(data stored in SCRATCH zone)

EMBL: CP002105.PE267

CP002105.PE267       Location/Qualifiers
FT   CDS             287244..289046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0270"
FT                   /product="NAD(P)-dependent iron-only hydrogenase diaphorase
FT                   component flavoprotein"
FT                   /EC_number="1.6.99.5"
FT                   /note="COGs: COG1894 NADH:ubiquinone oxidoreductase
FT                   NADH-binding (51 kD) subunit;
FT                   InterProIPR017900:IPR001949:IPR011538:IPR019554:IPR
FT                   019575:IPR001450:IPR012335:IPR012336:IPR017896; KEGG:
FT                   chy:CHY_0732 Fe-hydrogenase, beta subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase domain 51 kDa subunit;
FT                   Soluble ligand binding domain; NADH ubiquinone
FT                   oxidoreductase, F subunit, iron sulphur binding; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; PRIAM: NADH
FT                   dehydrogenase (quinone); SPTR: A1HP38 NADH dehydrogenase
FT                   (Quinone); PFAM: NADH-ubiquinone oxidoreductase-F
FT                   iron-sulfur binding region; 4Fe-4S binding domain;
FT                   Respiratory-chain NADH dehydrogenase 24 Kd subunit;
FT                   Respiratory-chain NADH dehydrogenase 51 Kd subunit; SLBB
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11819"
FT                   /db_xref="GOA:D9QTQ5"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTQ5"
FT                   /protein_id="ADL11819.1"
FT                   /translation="MVDSIYRSHIIICGGTGCVSSGCEEVQKALEDELDKQDLTDEINI
FT                   VETGCHGLCEKGPVMVIYPEGIFYCELQPEDMEELVTEHILKDRIVDRLLYKEPITEED
FT                   IPSYQNIDFYEKQQRVVLSNCGRVDPESIKEYIAEDGYQAVGETLTTMTSQEVIDEVKE
FT                   AGLRGRGGGGFPTGIKWQFAHDSEDDKKYIICNADEGDPGAFMDRSILEGDPHRVIEGM
FT                   IIAAYAIGASEGYIYVRAEYPLAIERLEKAIEQAEEYGLLGDNLFESGFDFKLQIKKGA
FT                   GAFVCGEETALMNSIEGKRGMPRPRPPFPAQKGLWGYPSNINNVETYANVPVIINQGAD
FT                   EYSKVGTEDSTGTKIFAITGKIQNTGLAEVPMGITMREIIYDVGGGIMGGKDFKAVQIG
FT                   GPSGGCLPEEKLDLSVDYDSLIEAGAMMGSGGLVVMDEDTCMVDVAKFFLDFTQSESCG
FT                   KCTPCREGTKRMLEILKRITAGEGKEGDIELLEELSHHIKSTSLCGLGQSAPNPVLSTI
FT                   QYFRDEYEAHIYEETCPAGNCQELVAGYVIDEEDCIGCTSCVDVCPVDAIEGEKKEAHV
FT                   IDTDECINCGSCVDECPVDAISQA"
     MVDSIYRSHI IICGGTGCVS SGCEEVQKAL EDELDKQDLT DEINIVETGC HGLCEKGPVM        60
     VIYPEGIFYC ELQPEDMEEL VTEHILKDRI VDRLLYKEPI TEEDIPSYQN IDFYEKQQRV       120
     VLSNCGRVDP ESIKEYIAED GYQAVGETLT TMTSQEVIDE VKEAGLRGRG GGGFPTGIKW       180
     QFAHDSEDDK KYIICNADEG DPGAFMDRSI LEGDPHRVIE GMIIAAYAIG ASEGYIYVRA       240
     EYPLAIERLE KAIEQAEEYG LLGDNLFESG FDFKLQIKKG AGAFVCGEET ALMNSIEGKR       300
     GMPRPRPPFP AQKGLWGYPS NINNVETYAN VPVIINQGAD EYSKVGTEDS TGTKIFAITG       360
     KIQNTGLAEV PMGITMREII YDVGGGIMGG KDFKAVQIGG PSGGCLPEEK LDLSVDYDSL       420
     IEAGAMMGSG GLVVMDEDTC MVDVAKFFLD FTQSESCGKC TPCREGTKRM LEILKRITAG       480
     EGKEGDIELL EELSHHIKST SLCGLGQSAP NPVLSTIQYF RDEYEAHIYE ETCPAGNCQE       540
     LVAGYVIDEE DCIGCTSCVD VCPVDAIEGE KKEAHVIDTD ECINCGSCVD ECPVDAISQA       600
//

If you have problems or comments...

PBIL Back to PBIL home page