(data stored in SCRATCH zone)

EMBL: CP002105.PE271

CP002105.PE271       Location/Qualifiers
FT   CDS             292491..293213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0274"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="COGs: COG1126 ABC-type polar amino acid transport
FT                   system ATPase component; InterPro
FT                   IPR017871:IPR003439:IPR003593; KEGG: chy:CHY_0506 glutamine
FT                   ABC transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: Q3AES0 Glutamine ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11823"
FT                   /db_xref="GOA:D9QU30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU30"
FT                   /protein_id="ADL11823.1"
FT                   /translation="MIKIENLYKNFGDLEVLKDINLEIDAGEVVVIIGPSGSGKSTVLR
FT                   CINLLEELTSGQIYIEETPMDDPETDINLMRQKVGMVFQQFNLFPHKTSLENITLAPTK
FT                   VKKLAEDEAENIAYELLDKVGLQDKADVYPAQLSGGQKQRIAIARALAMEPKVMLFDEP
FT                   TSALDPEMVGEVLEVMGTLAQEGMTMAVVTHEMGFAREVGDRICFMDEGRIVETGPPTQ
FT                   IFDNPQEERTQEFLSKIL"
     MIKIENLYKN FGDLEVLKDI NLEIDAGEVV VIIGPSGSGK STVLRCINLL EELTSGQIYI        60
     EETPMDDPET DINLMRQKVG MVFQQFNLFP HKTSLENITL APTKVKKLAE DEAENIAYEL       120
     LDKVGLQDKA DVYPAQLSGG QKQRIAIARA LAMEPKVMLF DEPTSALDPE MVGEVLEVMG       180
     TLAQEGMTMA VVTHEMGFAR EVGDRICFMD EGRIVETGPP TQIFDNPQEE RTQEFLSKIL       240
//

If you have problems or comments...

PBIL Back to PBIL home page