(data stored in SCRATCH zone)

EMBL: CP002105.PE276

CP002105.PE276       Location/Qualifiers
FT   CDS             298439..300421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hor:Hore_16410 hypothetical protein; SPTR:
FT                   B8CYM1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11828"
FT                   /db_xref="GOA:D9QU35"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU35"
FT                   /protein_id="ADL11828.1"
FT                   /translation="MYKKVLIILIIAGMITGAVIGYQRYQVETGNRSVELILDLKQWQK
FT                   LKLPPGVDLAALLEKYESQGVTSLAIIEQDLGDLEASGKVKLVTDLELRLLKETVGNNF
FT                   QQMTSIFCRTPQLKQKIEERLSSYLGDNKVVTADRKLLAAEADQQQLVDFPIGFTAEQL
FT                   DLARRSGLKVVPRFGNQAVDDSKAIKDRFSELNTLPQAALSQVIFSGTEVLGYPDYLSA
FT                   TAALIEEYDLQLGIIEPFIAEQTGVNRLANNLGPNNIRVHSADQQEFNLLPVEKLVDRY
FT                   LRAVRERNVRGVYLKPILESKDGRSAVELTNQLVADLTAGLQAEGYSLAPAEPISDFSS
FT                   SLLFLFIINLAAVAALFYLVEYLFISEFPLVVAGRYKLILFLISALVSLVLISQDYIFL
FT                   TRELTALLVAIIFPTLAVVSTLFPYIFSNQEIENRIKALFNIFVRVSLITLSGGVLLVG
FT                   ALGSWHYMVKLRQFRGVKLSFIGPILLVIAYYLHYRFWLNREDYSFQALIDKANSLLNK
FT                   NLKLKDLFLLIFLAVVGIIYIGRTGNQPLIPVPELELIIRDWLEQLLSVRPRFKSFLIG
FT                   HPLLVMATWLIITGNRDWSIPVLLGGLVGQITVMNTFSHIHTPLWTSGVRVGLGLMLGF
FT                   VIGILLVKLGRGLLIWKQKLRKELD"
     MYKKVLIILI IAGMITGAVI GYQRYQVETG NRSVELILDL KQWQKLKLPP GVDLAALLEK        60
     YESQGVTSLA IIEQDLGDLE ASGKVKLVTD LELRLLKETV GNNFQQMTSI FCRTPQLKQK       120
     IEERLSSYLG DNKVVTADRK LLAAEADQQQ LVDFPIGFTA EQLDLARRSG LKVVPRFGNQ       180
     AVDDSKAIKD RFSELNTLPQ AALSQVIFSG TEVLGYPDYL SATAALIEEY DLQLGIIEPF       240
     IAEQTGVNRL ANNLGPNNIR VHSADQQEFN LLPVEKLVDR YLRAVRERNV RGVYLKPILE       300
     SKDGRSAVEL TNQLVADLTA GLQAEGYSLA PAEPISDFSS SLLFLFIINL AAVAALFYLV       360
     EYLFISEFPL VVAGRYKLIL FLISALVSLV LISQDYIFLT RELTALLVAI IFPTLAVVST       420
     LFPYIFSNQE IENRIKALFN IFVRVSLITL SGGVLLVGAL GSWHYMVKLR QFRGVKLSFI       480
     GPILLVIAYY LHYRFWLNRE DYSFQALIDK ANSLLNKNLK LKDLFLLIFL AVVGIIYIGR       540
     TGNQPLIPVP ELELIIRDWL EQLLSVRPRF KSFLIGHPLL VMATWLIITG NRDWSIPVLL       600
     GGLVGQITVM NTFSHIHTPL WTSGVRVGLG LMLGFVIGIL LVKLGRGLLI WKQKLRKELD       660
//

If you have problems or comments...

PBIL Back to PBIL home page