(data stored in SCRATCH zone)

EMBL: CP002105.PE279

CP002105.PE279       Location/Qualifiers
FT   CDS             302274..303128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0282"
FT                   /product="Protein of unknown function DUF2179"
FT                   /note="COGs: COG1284 conserved hypothetical protein;
FT                   InterPro IPR003740:IPR019264; KEGG: hor:Hore_16380
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   DUF2179; protein of unknown function DUF161; SPTR: B8CYL8
FT                   Uncharacterized conserved protein; PFAM: Uncharacterized
FT                   BCR, YitT family COG1284; Uncharacterized protein conserved
FT                   in bacteria (DUF2179)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11831"
FT                   /db_xref="GOA:D9QU38"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU38"
FT                   /protein_id="ADL11831.1"
FT                   /translation="MKREIVYDYLGITLGSIFTAIGLVVFLVPNKIASGGISGLATVVY
FT                   HLFNFPVGRTILVINVPLFIIGVKVLGTKFGVRTLYGILVLSLATDYLVPYLPVLTHDL
FT                   LLAAIYGGVFVGTGLGLVFRFKGTTGGTDLVAQLVNYYFNISVGKALLMIDFCVIFSAA
FT                   IAFNAEVALYALIALFITSKAIDLVQEGFNISKGAFIISDEDREIKEEILHKLDRGVTV
FT                   LEGKGGYTNSDKEILLCIISRSEVTRLKNLVYNLDQEAFLIITDVHEVLGEGFNESMVR
FT                   RSE"
     MKREIVYDYL GITLGSIFTA IGLVVFLVPN KIASGGISGL ATVVYHLFNF PVGRTILVIN        60
     VPLFIIGVKV LGTKFGVRTL YGILVLSLAT DYLVPYLPVL THDLLLAAIY GGVFVGTGLG       120
     LVFRFKGTTG GTDLVAQLVN YYFNISVGKA LLMIDFCVIF SAAIAFNAEV ALYALIALFI       180
     TSKAIDLVQE GFNISKGAFI ISDEDREIKE EILHKLDRGV TVLEGKGGYT NSDKEILLCI       240
     ISRSEVTRLK NLVYNLDQEA FLIITDVHEV LGEGFNESMV RRSE                        284
//

If you have problems or comments...

PBIL Back to PBIL home page