(data stored in SCRATCH zone)

EMBL: CP002105.PE308

CP002105.PE308       Location/Qualifiers
FT   CDS             335220..336422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0311"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: dae:Dtox_0787 glycosyl transferase group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: A5CZ90
FT                   Glycosyltransferase; PFAM: Starch synthase catalytic
FT                   domain; Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11860"
FT                   /db_xref="GOA:D9QU67"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU67"
FT                   /protein_id="ADL11860.1"
FT                   /translation="MRVLMVSWEYPPVSIGGLASHVEELSQALVEEDVEVHLITQGGEV
FT                   SDRYAEENGVYIYRVDKPDISTPDFLTWAMLVNYNFLEVANRLVNELDFDLIHIHDWLV
FT                   GFTGKTLKHSYHLPLVVTIHATESGRNHGIYNSHQQYINDVEWLLGYESWRVICCSEYM
FT                   REEIHGLFQTPKDKIDIINNGVNLDTFDVEVESGFKDKYTDGNLVFYIGRLVQEKGVQH
FT                   LLEAVPQVLSTAPNTEFVIAGKGPKLDELKDQAHRMGIADHVTFPGYISEEEKEKLYQV
FT                   ADTAVFPSLYEPFGIVALEAMASKTPVVVSGVGGFDEIVDDGQDGLKALPGNPDSLAEK
FT                   IIKLLTDHNYAESLRNNGYRKAVEEYSWQGIARQTKEVYNQVLTKYLDSDWRHVEPITT
FT                   I"
     MRVLMVSWEY PPVSIGGLAS HVEELSQALV EEDVEVHLIT QGGEVSDRYA EENGVYIYRV        60
     DKPDISTPDF LTWAMLVNYN FLEVANRLVN ELDFDLIHIH DWLVGFTGKT LKHSYHLPLV       120
     VTIHATESGR NHGIYNSHQQ YINDVEWLLG YESWRVICCS EYMREEIHGL FQTPKDKIDI       180
     INNGVNLDTF DVEVESGFKD KYTDGNLVFY IGRLVQEKGV QHLLEAVPQV LSTAPNTEFV       240
     IAGKGPKLDE LKDQAHRMGI ADHVTFPGYI SEEEKEKLYQ VADTAVFPSL YEPFGIVALE       300
     AMASKTPVVV SGVGGFDEIV DDGQDGLKAL PGNPDSLAEK IIKLLTDHNY AESLRNNGYR       360
     KAVEEYSWQG IARQTKEVYN QVLTKYLDSD WRHVEPITTI                             400
//

If you have problems or comments...

PBIL Back to PBIL home page