(data stored in SCRATCH zone)

EMBL: CP002105.PE310

CP002105.PE310       Location/Qualifiers
FT   CDS             339002..339916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0313"
FT                   /product="phosphotransferase system PTS sorbose-specific
FT                   IIC subunit"
FT                   /note="InterPro IPR004700; KEGG: hor:Hore_15910
FT                   hypothetical protein; PFAM: phosphotransferase system PTS
FT                   sorbose-specific IIC subunit; SPTR: B8CYH1 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11862"
FT                   /db_xref="GOA:D9QU69"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU69"
FT                   /protein_id="ADL11862.1"
FT                   /translation="MIKLFSLALLINSINFLERRLKCSSYRYLLHPILVAPLGGALLGN
FT                   LSTGIYIGLLLEVIWGSNLFDYDFGLQYVNLAAILTTVLTLVTGNISLILNLTIAVIIT
FT                   YLLQEAIIMLDSKTNQWIIEIGLFFFIFTLLNFTPVLKGLLGEIPAQFLDQLAVASGLL
FT                   PGLGLAVILAQIIVSEDLGSNLKLSYLLVLVILLLLSQWFNWLLPVLFIVIWGGGYLLV
FT                   KKFKVSSYFLRLAIGGLVIAAAPLVVEITGPMVDSQLKLVLWSEAFLSVSTLGLLLFRI
FT                   TQFELYFICLILGVIASRAGLLL"
     MIKLFSLALL INSINFLERR LKCSSYRYLL HPILVAPLGG ALLGNLSTGI YIGLLLEVIW        60
     GSNLFDYDFG LQYVNLAAIL TTVLTLVTGN ISLILNLTIA VIITYLLQEA IIMLDSKTNQ       120
     WIIEIGLFFF IFTLLNFTPV LKGLLGEIPA QFLDQLAVAS GLLPGLGLAV ILAQIIVSED       180
     LGSNLKLSYL LVLVILLLLS QWFNWLLPVL FIVIWGGGYL LVKKFKVSSY FLRLAIGGLV       240
     IAAAPLVVEI TGPMVDSQLK LVLWSEAFLS VSTLGLLLFR ITQFELYFIC LILGVIASRA       300
     GLLL                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page