(data stored in SCRATCH zone)

EMBL: CP002105.PE324

CP002105.PE324       Location/Qualifiers
FT   CDS             354619..354918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0327"
FT                   /product="protein translocase subunit secG"
FT                   /note="InterPro IPR004692; KEGG: hor:Hore_15770 preprotein
FT                   translocase, SecG subunit; PFAM: Preprotein translocase
FT                   SecG subunit; SPTR: B8CYF7 Preprotein translocase, SecG
FT                   subunit; TIGRFAM: preprotein translocase, SecG subunit;
FT                   PFAM: Preprotein translocase SecG subunit; TIGRFAM: protein
FT                   translocase, SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11876"
FT                   /db_xref="GOA:D9QU83"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU83"
FT                   /protein_id="ADL11876.1"
FT                   /translation="MEFLLFFLWDYVKIDNGNLIEKKEVKNVFVLKVIHLIISLALIAG
FT                   VLLQSGKSAGLSGAIDGGASSFFDQGRQAEEKIKKLTTVAAILFMISSLVLAAL"
     MEFLLFFLWD YVKIDNGNLI EKKEVKNVFV LKVIHLIISL ALIAGVLLQS GKSAGLSGAI        60
     DGGASSFFDQ GRQAEEKIKK LTTVAAILFM ISSLVLAAL                               99
//

If you have problems or comments...

PBIL Back to PBIL home page