(data stored in SCRATCH zone)

EMBL: CP002105.PE334

CP002105.PE334       Location/Qualifiers
FT   CDS             369401..370657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0339"
FT                   /product="HNH endonuclease"
FT                   /note="InterPro IPR003615:IPR002711; KEGG: fma:FMG_P0170
FT                   hypothetical protein; PFAM: HNH endonuclease; SMART: HNH
FT                   nuclease; SPTR: B0S4M8 Putative uncharacterized protein;
FT                   PFAM: HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11886"
FT                   /db_xref="GOA:D9QU93"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU93"
FT                   /protein_id="ADL11886.1"
FT                   /translation="MAINYAFVLDNEGKMLDPTKAKKAWYLIRQGKAELVEEYPLIIQL
FT                   NRTVPSSQINDDEIVLGIDDGAKYVGVALVQDCKTKNKVLFKAKMKQRQDVSAKMEERN
FT                   DYRGYRRSHKRYRPKRFDNRFASKRKGRLPPSIKQRKQAILRVVKHLSKHIRLDKIILE
FT                   DVSIDIRKLTEGEELYSWQYQESNRLDENLRKATLKRDDYTCQLCEVEDTMLHAHHIIP
FT                   VRDGGADSIYNLITLCADCHNNKVDNNEYKYKDQLLTKIDGKELNLKPAMHVMQGKSWL
FT                   REELSTMAKLEITTGGDTANRRIDYNIEKTHSNDAICITGLLPIDRLDIKGYFIKPLRK
FT                   KRASKIDSLGDFKHRDVIRYIKRDGTTYLGYITALRVKNNKYNSKVCNFTTLDGEKTFR
FT                   GYGLTNLTLVNRPQGLMII"
     MAINYAFVLD NEGKMLDPTK AKKAWYLIRQ GKAELVEEYP LIIQLNRTVP SSQINDDEIV        60
     LGIDDGAKYV GVALVQDCKT KNKVLFKAKM KQRQDVSAKM EERNDYRGYR RSHKRYRPKR       120
     FDNRFASKRK GRLPPSIKQR KQAILRVVKH LSKHIRLDKI ILEDVSIDIR KLTEGEELYS       180
     WQYQESNRLD ENLRKATLKR DDYTCQLCEV EDTMLHAHHI IPVRDGGADS IYNLITLCAD       240
     CHNNKVDNNE YKYKDQLLTK IDGKELNLKP AMHVMQGKSW LREELSTMAK LEITTGGDTA       300
     NRRIDYNIEK THSNDAICIT GLLPIDRLDI KGYFIKPLRK KRASKIDSLG DFKHRDVIRY       360
     IKRDGTTYLG YITALRVKNN KYNSKVCNFT TLDGEKTFRG YGLTNLTLVN RPQGLMII         418
//

If you have problems or comments...

PBIL Back to PBIL home page