(data stored in SCRATCH zone)

EMBL: CP002105.PE336

CP002105.PE336       Location/Qualifiers
FT   CDS             373370..374764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0341"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="COGs: COG0312 Zn-dependent protease and their
FT                   inactivated homologs; InterPro IPR002510; KEGG:
FT                   mta:Moth_1542 microcin-processing peptidase 2; PFAM:
FT                   peptidase U62 modulator of DNA gyrase; SPTR: Q2RI88
FT                   Putative uncharacterized protein; PFAM: Putative modulator
FT                   of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11888"
FT                   /db_xref="GOA:D9QU95"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU95"
FT                   /protein_id="ADL11888.1"
FT                   /translation="MLSEERIDKVLKSALDKGGEFAELFFEKKESNQLSMESSRLEKVK
FT                   TGFDLGVGIRVINGDQVSYAYTDDITLDSLLKTAKAAGTASKYNEDVTINNLQQKNTDS
FT                   VHQIEVRPETVEKLKKKEVLKTADKSARSVDQRIQQVMVSYIDYYQQVLIANSTGLLVE
FT                   DERVRTRLMVNAIASDGKIIQTGRETPGKHVGFELFDEYSPEEVGKKAGQKAITMLEAR
FT                   PAPSARMPVVVNHGFGGVLFHEACGHGLEADAVQKGSSVYTGRIGEQVANEKVTAIDDA
FT                   TVLNEWGSFVVDDEGHEAEETVLIKDGELTDYMYDYKTAKKEDRESTGNGRRQSYQSRP
FT                   IPRMTNTFIAPGESKPQEIINSVDQGLYAKSLSGGQVEPATGDFTFTVAEGYLIEDGEV
FT                   SEPVRNATLVGNGPESLHRITMVGDDLEHAPGMCGKEGQSIPAAVGQPTLLIEELTVGG
FT                   TEREEE"
     MLSEERIDKV LKSALDKGGE FAELFFEKKE SNQLSMESSR LEKVKTGFDL GVGIRVINGD        60
     QVSYAYTDDI TLDSLLKTAK AAGTASKYNE DVTINNLQQK NTDSVHQIEV RPETVEKLKK       120
     KEVLKTADKS ARSVDQRIQQ VMVSYIDYYQ QVLIANSTGL LVEDERVRTR LMVNAIASDG       180
     KIIQTGRETP GKHVGFELFD EYSPEEVGKK AGQKAITMLE ARPAPSARMP VVVNHGFGGV       240
     LFHEACGHGL EADAVQKGSS VYTGRIGEQV ANEKVTAIDD ATVLNEWGSF VVDDEGHEAE       300
     ETVLIKDGEL TDYMYDYKTA KKEDRESTGN GRRQSYQSRP IPRMTNTFIA PGESKPQEII       360
     NSVDQGLYAK SLSGGQVEPA TGDFTFTVAE GYLIEDGEVS EPVRNATLVG NGPESLHRIT       420
     MVGDDLEHAP GMCGKEGQSI PAAVGQPTLL IEELTVGGTE REEE                        464
//

If you have problems or comments...

PBIL Back to PBIL home page