(data stored in SCRATCH zone)

EMBL: CP002105.PE34

CP002105.PE34        Location/Qualifiers
FT   CDS             36999..37574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0034"
FT                   /product="pyruvate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="COGs: COG1014 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase gamma subunit;
FT                   InterPro IPR019752:IPR002869:IPR011894; KEGG:
FT                   hor:Hore_20740 pyruvate ferredoxin oxidoreductase, gamma
FT                   subunit; PFAM: Pyruvate/ketoisovalerate oxidoreductase;
FT                   PRIAM: Pyruvate synthase; SPTR: B8CZW7 Pyruvate ferredoxin
FT                   oxidoreductase, gamma subunit; TIGRFAM:
FT                   pyruvate/ketoisovalerate oxidoreductase, gamma subunit;
FT                   PFAM: Pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   TIGRFAM: 2-oxoacid:acceptor oxidoreductase, gamma subunit,
FT                   pyruvate/2-ketoisovalerate family"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11586"
FT                   /db_xref="GOA:D9QSP8"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSP8"
FT                   /protein_id="ADL11586.1"
FT                   /translation="MANLTEIRWHGRGGQGAKTASILLGKVASKTGKNIQAFPEYGPER
FT                   MGAPVLAFNRISDEELTVHCQVTEPSIVTVLDPTLLEAVDVTEGIPADGKIIINTTKSP
FT                   TDVKKELDFEGEVYTVDADGISTDEIGAAFPNTPMLGALVKVTDLLEFDNFKEQVEKEF
FT                   KKKFASKPEVIDGNMKSIERAYQEVKSE"
     MANLTEIRWH GRGGQGAKTA SILLGKVASK TGKNIQAFPE YGPERMGAPV LAFNRISDEE        60
     LTVHCQVTEP SIVTVLDPTL LEAVDVTEGI PADGKIIINT TKSPTDVKKE LDFEGEVYTV       120
     DADGISTDEI GAAFPNTPML GALVKVTDLL EFDNFKEQVE KEFKKKFASK PEVIDGNMKS       180
     IERAYQEVKS E                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page