(data stored in SCRATCH zone)

EMBL: CP002105.PE342

CP002105.PE342       Location/Qualifiers
FT   CDS             378963..379541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0347"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="COGs: COG0741 Soluble lytic murein transglycosylase
FT                   and related regulatory protein (some contain LysM/invasin
FT                   domains); InterPro IPR008258; KEGG: dae:Dtox_2419 lytic
FT                   transglycosylase catalytic; PFAM: Lytic transglycosylase
FT                   catalytic; SPTR: C1TF21 Soluble lytic murein
FT                   transglycosylase-like protein; PFAM: Transglycosylase SLT
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11894"
FT                   /db_xref="GOA:D9QUA1"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUA1"
FT                   /protein_id="ADL11894.1"
FT                   /translation="MVIGPKELKIILIILLCLIISAVVIINFKNILKIFYPLYYEDLIF
FT                   KYAEKNNLDPYLVAAVIRVESKFNSEATSRQGARGLMQIMPETGEWIADQLKIDDFDTD
FT                   DLYDPEVNISFGSWYLAHLKRFFDGNLTVVIAAYNGGQGNVNKWLELKEWTGKEKDSKQ
FT                   IPFPETRDYVEKVLNTYQWYHKIYRPETR"
     MVIGPKELKI ILIILLCLII SAVVIINFKN ILKIFYPLYY EDLIFKYAEK NNLDPYLVAA        60
     VIRVESKFNS EATSRQGARG LMQIMPETGE WIADQLKIDD FDTDDLYDPE VNISFGSWYL       120
     AHLKRFFDGN LTVVIAAYNG GQGNVNKWLE LKEWTGKEKD SKQIPFPETR DYVEKVLNTY       180
     QWYHKIYRPE TR                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page