(data stored in SCRATCH zone)

EMBL: CP002105.PE344

CP002105.PE344       Location/Qualifiers
FT   CDS             380875..381828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0349"
FT                   /product="selenide, water dikinase"
FT                   /note="COGs: COG0709 Selenophosphate synthase; InterPro
FT                   IPR016188:IPR010918:IPR004536:IPR000728; KEGG:
FT                   mta:Moth_1625 selenophosphate synthase; PFAM: AIR synthase
FT                   related protein; AIR synthase related protein domain
FT                   protein; SPTR: Q2RI12 Selenophosphate synthase; TIGRFAM:
FT                   selenide, water dikinase; PFAM: AIR synthase related
FT                   protein, N-terminal domain; AIR synthase related protein,
FT                   C-terminal domain; TIGRFAM: selenium donor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11896"
FT                   /db_xref="GOA:D9QUA3"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUA3"
FT                   /protein_id="ADL11896.1"
FT                   /translation="MRSVPTVTNERELVGLSTSDDASVIKLNEKQALIQSLDFFTPVVE
FT                   DPYLFGQIAAANALSDIYAMGGEPLSAMNIVGFPPELDTEILEKILQGGADKVKEAGAI
FT                   LAGGHTIEDEETKYGLSASGLVAPADMVSNAGAEPGDKLVLTKPLGIGIAVTAINGGLS
FT                   PGGENSPAIQEMLTLNKDAAEVMQKIGVNAATDVTGFGLLGHLWELVSASGVQAVVNFS
FT                   TIPLLSEVIEWAEMGLVPGGAYSNQEYINEHIDFTAGFEEAKQNVLFDPQTSGGLLISV
FT                   TADKADKLEIALQKKGVTSAIIGRIESGEAAIKVKE"
     MRSVPTVTNE RELVGLSTSD DASVIKLNEK QALIQSLDFF TPVVEDPYLF GQIAAANALS        60
     DIYAMGGEPL SAMNIVGFPP ELDTEILEKI LQGGADKVKE AGAILAGGHT IEDEETKYGL       120
     SASGLVAPAD MVSNAGAEPG DKLVLTKPLG IGIAVTAING GLSPGGENSP AIQEMLTLNK       180
     DAAEVMQKIG VNAATDVTGF GLLGHLWELV SASGVQAVVN FSTIPLLSEV IEWAEMGLVP       240
     GGAYSNQEYI NEHIDFTAGF EEAKQNVLFD PQTSGGLLIS VTADKADKLE IALQKKGVTS       300
     AIIGRIESGE AAIKVKE                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page