(data stored in SCRATCH zone)

EMBL: CP002105.PE347

CP002105.PE347       Location/Qualifiers
FT   CDS             385142..386131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0352"
FT                   /product="trimethylamine methyltransferase"
FT                   /note="COGs: COG5598 Trimethylamine:corrinoid
FT                   methyltransferase; InterPro IPR010426; KEGG: dsy:DSY4970
FT                   hypothetical protein; PFAM: trimethylamine
FT                   methyltransferase; SPTR: Q24MI3 Trimethylamine
FT                   methyltransferase mttB; PFAM: Trimethylamine
FT                   methyltransferase (MTTB)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11899"
FT                   /db_xref="GOA:D9QUA6"
FT                   /db_xref="InterPro:IPR010426"
FT                   /db_xref="InterPro:IPR038601"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUA6"
FT                   /protein_id="ADL11899.1"
FT                   /translation="MTIRNSRSYYPNKTGFSVDMFTDEELEEIHLATLEMLWDNGMHVT
FT                   NEEALDIFADAGAKVNRSEGKVRIPPYMVEDAIKSAPPQILMAGRDPENDVVIGGSRVN
FT                   FTTFGAGVKIEDLETGGLRDTLKQDVADTALVADYLDQIDIYSHAVTGGDSPDANIDLH
FT                   DAEAFLNNTTKHCHHIDLTCGENAKKYFEMGAAIMGGMDELRERPIISGLVCPQSPLEL
FT                   HGDAAQIIIEHARAGIPVNVLSMAMSGATCPVSVAGTLVDHNAEVLTGVILTQLVNKGA
FT                   PVIYGSSTTTFDLQHSTAPVGAPELGMCNAGVAKLARYYNLPSYTAGG"
     MTIRNSRSYY PNKTGFSVDM FTDEELEEIH LATLEMLWDN GMHVTNEEAL DIFADAGAKV        60
     NRSEGKVRIP PYMVEDAIKS APPQILMAGR DPENDVVIGG SRVNFTTFGA GVKIEDLETG       120
     GLRDTLKQDV ADTALVADYL DQIDIYSHAV TGGDSPDANI DLHDAEAFLN NTTKHCHHID       180
     LTCGENAKKY FEMGAAIMGG MDELRERPII SGLVCPQSPL ELHGDAAQII IEHARAGIPV       240
     NVLSMAMSGA TCPVSVAGTL VDHNAEVLTG VILTQLVNKG APVIYGSSTT TFDLQHSTAP       300
     VGAPELGMCN AGVAKLARYY NLPSYTAGG                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page