(data stored in SCRATCH zone)

EMBL: CP002105.PE350

CP002105.PE350       Location/Qualifiers
FT   CDS             387459..387743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_15230 hypothetical protein; SPTR:
FT                   C0Q9R8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11902"
FT                   /db_xref="GOA:D9QUA9"
FT                   /db_xref="InterPro:IPR023878"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUA9"
FT                   /protein_id="ADL11902.1"
FT                   /translation="MAQYTFRKKQDLFSLLKEMKLWPSRSGLLHGIKSIDTLGNYARLT
FT                   LYCGQEITVKNSKNSRAARWLRNTMMIEPCTECEVPDWKIEKYSNTTFK"
     MAQYTFRKKQ DLFSLLKEMK LWPSRSGLLH GIKSIDTLGN YARLTLYCGQ EITVKNSKNS        60
     RAARWLRNTM MIEPCTECEV PDWKIEKYSN TTFK                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page