(data stored in SCRATCH zone)

EMBL: CP002105.PE361

CP002105.PE361       Location/Qualifiers
FT   CDS             399149..399733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0366"
FT                   /product="RnfA-Nqr electron transport subunit"
FT                   /note="COGs: COG2209 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase subunit NqrE; InterPro IPR003667; KEGG:
FT                   acl:ACL_0969 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase subunit E; PFAM: RnfA-Nqr electron transport
FT                   subunit; SPTR: A9NGU9 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase subunit E; PFAM: Rnf-Nqr subunit, membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11913"
FT                   /db_xref="GOA:D9QUC0"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUC0"
FT                   /protein_id="ADL11913.1"
FT                   /translation="MPESLSIFIAAITSHNLALTYILGMCPMLGVSKNLDTAVGMGISV
FT                   AFVVVVTSMVNWGIYNLILVPTGTEILNYVVFIVVIGASVQLLEMILEKFLPALYRAFG
FT                   IFLPLITVNCVVLSISLFMTLRNYDFITTLVFALGSAIGWLIAIAIVAAIREKLKLTGD
FT                   VPRGLQGPGIVMIILGIVALAFMGFGGMVSV"
     MPESLSIFIA AITSHNLALT YILGMCPMLG VSKNLDTAVG MGISVAFVVV VTSMVNWGIY        60
     NLILVPTGTE ILNYVVFIVV IGASVQLLEM ILEKFLPALY RAFGIFLPLI TVNCVVLSIS       120
     LFMTLRNYDF ITTLVFALGS AIGWLIAIAI VAAIREKLKL TGDVPRGLQG PGIVMIILGI       180
     VALAFMGFGG MVSV                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page