(data stored in SCRATCH zone)

EMBL: CP002105.PE362

CP002105.PE362       Location/Qualifiers
FT   CDS             399734..400825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0367"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="COGs: COG2871 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase subunit NqrF;
FT                   InterProIPR012675:IPR001221:IPR001709:IPR001041:IPR
FT                   017927:IPR017938:IPR008333:IPR001433; KEGG: acl:ACL_0970
FT                   Na+-transporting NADH:ubiquinone oxidoreductase subunit F;
FT                   PFAM: oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   Oxidoreductase FAD-binding domain protein; ferredoxin;
FT                   SPTR: A9NGV0 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase subunit F; PFAM: 2Fe-2S iron-sulfur cluster
FT                   binding domain; Oxidoreductase FAD-binding domain;
FT                   Oxidoreductase NAD-binding domain; TIGRFAM: NADH:ubiquinone
FT                   oxidoreductase, Na(+)-translocating, F subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11914"
FT                   /db_xref="GOA:D9QUC1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUC1"
FT                   /protein_id="ADL11914.1"
FT                   /translation="MNIQPIYILASIFFGVAFVLAIADFLLTSNEQQVININDEEYIPA
FT                   GDGTLLEVLGENGIFIPAGCGGKASCGQCKVTVKEGGGDILPTEEPFLDEEEREEGVRL
FT                   ACQVKVNEDMKLELDESLLDIEEYTARVAEVRSVTPTVKHVRLEMIEPTDIEFEAGQYA
FT                   QIMIPGFEEYRAYSIASPPSMAREENALQFTIKLVPGGLCTSWVHFAMEEGDIVKFTGP
FT                   FGHFYLDEESDREIILIGGGAGMAPMRGILERLDELGMPRPTRYYFGARNSDELYYGDR
FT                   FAELEEKYDNFEYIPALSDPTPEDKKNWDGPTGFVTDVLDEREGSLENAESYLCGPPPM
FT                   LDAAERILVDHGMPEEKVMFDKF"
     MNIQPIYILA SIFFGVAFVL AIADFLLTSN EQQVININDE EYIPAGDGTL LEVLGENGIF        60
     IPAGCGGKAS CGQCKVTVKE GGGDILPTEE PFLDEEEREE GVRLACQVKV NEDMKLELDE       120
     SLLDIEEYTA RVAEVRSVTP TVKHVRLEMI EPTDIEFEAG QYAQIMIPGF EEYRAYSIAS       180
     PPSMAREENA LQFTIKLVPG GLCTSWVHFA MEEGDIVKFT GPFGHFYLDE ESDREIILIG       240
     GGAGMAPMRG ILERLDELGM PRPTRYYFGA RNSDELYYGD RFAELEEKYD NFEYIPALSD       300
     PTPEDKKNWD GPTGFVTDVL DEREGSLENA ESYLCGPPPM LDAAERILVD HGMPEEKVMF       360
     DKF                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page